CoraLite® Plus 488-conjugated TAF12 Monoclonal antibody

• 

  FC experiment of HeLa using CL488-67621

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human TAF12 (CL488-67621, Clone:4E12D2)(red), or 0.8 ug CoraLite® Plus 488 Mouse IgG1 Isotype Control (MOPC-21) (CL488-65124, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

TAF12 Monoclonal Antibody for FC (Intra)

Cat No. CL488-67621

Clone No.4E12D2

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

FC (Intra)

Synonyms

TAF12, TAF15, TAF2J, TAFII 20/TAFII 15, TAFII20, TAFII20/TAFII15

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67621 targets TAF12 in FC (Intra) applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16597

  Product name: Recombinant human TAF12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-161 aa of BC011986

  Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

• Full Name: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC011986
• Gene Symbol: TAF12
• Gene ID (NCBI): 6883
• RRID: AB_3084365
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16514
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TAF12, also named TAF15 or TAF2J, is a TBP-associated factor that is contained in Pol I- and Pol II-specific TBP-TAF complexes, it is also a component of the transcription factor IID (TFIID) complex, which is essential for mediating regulation of RNA polymerase transcription. TAF12 plays a key role in regulating eukaryotic gene expression by directly binding promoters and enhancer-bound transactivator proteins. Likewise, TAF12 recruits Gadd45a and the nucleotide excision repair complex to the promoter of rRNA genes leading to active DNA demethylation