CoraLite® Plus 488-conjugated TAOK3 Monoclonal antibody

• 

  IF Staining of human prostate cancer using CL488-67451

  Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using CoraLite® Plus 488 TAOK3 antibody (CL488-67451, Clone: 1A5A9 ) at dilution of 1:200.

• 

  IF Staining of human prostate cancer using CL488-67451

  Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using CoraLite® Plus 488 TAOK3 antibody (CL488-67451, Clone: 1A5A9 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

TAOK3 Monoclonal Antibody for IF-P

Cat No. CL488-67451

Clone No.1A5A9

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF-P

Synonyms

DKFZp666H245, DPK, FLJ31808, hKFC A, JIK, JNK/SAPK inhibitory kinase, Jun kinase inhibitory kinase, KDS, Kinase from chicken homolog A, MAP3K18, TAO kinase 3, TAOK3

---

Tested Applications

• Positive IF-P detected in: human prostate cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67451 targets TAOK3 in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29146

  Product name: Recombinant human TAOK3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 366-430 aa of BC002756

  Sequence: SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR

• Full Name: TAO kinase 3
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 100-105 kDa
• GenBank Accession Number: BC002756
• Gene Symbol: TAOK3
• Gene ID (NCBI): 51347
• RRID: AB_2919477
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H2K8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TAOK3(Serine/threonine-protein kinase TAO3) is also named as DPK, JIK, KDS, MAP3K18 and belongs to the STE Ser/Thr protein kinase family. It acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, it is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. And this protein can be autophosphorylated(PMID:20949042).