Use Able AI chat for product recommendations

TBR1 Polyclonal antibody

TBR1 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 20932-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

T box brain protein 1, T box, brain, 1, T brain 1, T-box brain protein 1, TBR 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman brain tissue, mouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20932-1-AP targets TBR1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14935

Product name: Recombinant human TBR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-196 aa of BC104844

Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQ

Predict reactive species
Full Name T-box, brain, 1
Calculated Molecular Weight 682 aa, 74 kDa
Observed Molecular Weight 74 kDa
GenBank Accession NumberBC104844
Gene Symbol TBR1
Gene ID (NCBI) 10716
RRIDAB_10695502
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16650
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBR1, also named as T-box brain protein 1, is a 682 amino acid protein, which contains one T-box DNA-binding domain and localizes in the nucleus. TBR1 is expressed in the brain and as a transcriptional regulator is involved in developmental processes. TBR1 is required for normal brain development.

Protocols

Product Specific Protocols
IF protocol for TBR1 antibody 20932-1-APDownload protocol
IHC protocol for TBR1 antibody 20932-1-APDownload protocol
IP protocol for TBR1 antibody 20932-1-APDownload protocol
WB protocol for TBR1 antibody 20932-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanIF

Nat Neurosci

A tau homeostasis signature is linked with the cellular and regional vulnerability of excitatory neurons to tau pathology.

Authors - Hongjun Fu
humanIF

Nat Commun

GRAMD1B is a regulator of lipid homeostasis, autophagic flux and phosphorylated tau

Authors - Diana Acosta Ingram
mouseIF

Nat Commun

Pathogenic POGZ mutation causes impaired cortical development and reversible autism-like phenotypes.

Authors - Kensuke Matsumura
mouseIF

Nat Commun

Disrupted neuronal maturation in Angelman syndrome-derived induced pluripotent stem cells.

Authors - James J Fink
mouseIHC

Mol Neurodegener

AIF3 splicing switch triggers neurodegeneration.

Authors - Shuiqiao Liu
humanIHC

Proc Natl Acad Sci U S A

Human intermediate progenitor diversity during cortical development.

Authors - Mark-Phillip Pebworth

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Raquel (Verified Customer) (03-04-2026)

Very nice and clean staining of TBR1 positive neurons

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Cortical brain organoids
TBR1 Antibody Immunofluorescence validation (1:100 dilution) in Cortical brain organoids (Cat no:20932-1-AP)

Reyes (Verified Customer) (03-01-2024)

Used on human brain cortical sections, it marked nicely the nucleus of my neurons.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
TBR1 Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:20932-1-AP)

Mandi (Verified Customer) (03-09-2020)

Good staining on iPSC-derived Cortical neurons. Needed a decent amount of optimization to prevent non-specific binding though. Make sure to run primary/secondary deletes.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: human cortical neurons
Loading...
||
New chat

Able

正在加载,请稍候...