CoraLite® Plus 488-conjugated TBR1 Polyclonal antibody

• 

  IF Staining of mouse brain using CL488-20932

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 TBR1 antibody (CL488-20932) at dilution of 1:200.

• 

  IF Staining of mouse brain using CL488-20932

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 TBR1 antibody (CL488-20932) at dilution of 1:200.

TBR1 Polyclonal Antibody for IF-P

Cat No. CL488-20932

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

T box brain protein 1, T box, brain, 1, T brain 1, TBR 1, TBR1, TES 56

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20932 targets TBR1 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14935

  Product name: Recombinant human TBR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC104844

  Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQ

• Full Name: T-box, brain, 1
• Calculated Molecular Weight: 682 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC104844
• Gene Symbol: TBR1
• Gene ID (NCBI): 10716
• RRID: AB_2919176
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16650
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TBR1, also named as T-box brain protein 1, is a 682 amino acid protein, which contains one T-box DNA-binding domain and localizes in the nucleus. TBR1 is expressed in the brain and as a transcriptional regulator is involved in developmental processes. TBR1 is required for normal brain development.