CoraLite®594-conjugated TBR1 Polyclonal antibody

TBR1 Polyclonal Antibody for IF-P
Cat No. CL594-20932

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

T box brain protein 1, T box, brain, 1, T brain 1, TBR 1, TBR1, TES 56

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-20932 targets TBR1 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14935

Product name: Recombinant human TBR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-196 aa of BC104844

Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQ

Predict reactive species
Full Name T-box, brain, 1
Calculated Molecular Weight 682 aa, 74 kDa
Observed Molecular Weight 74 kDa
GenBank Accession NumberBC104844
Gene Symbol TBR1
Gene ID (NCBI) 10716
RRIDAB_2919857
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16650
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TBR1, also named as T-box brain protein 1, is a 682 amino acid protein, which contains one T-box DNA-binding domain and localizes in the nucleus. TBR1 is expressed in the brain and as a transcriptional regulator is involved in developmental processes. TBR1 is required for normal brain development.

Protocols

Product Specific Protocols
IF protocol for CL594 TBR1 antibody CL594-20932Download protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Etienne (Verified Customer) (12-19-2022)

Worked great. Very crisp staining with absolutely no noise. Definitely doing to use again. I found the best dilution to be 1/200

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/50, 1/200, 1/500
  • Cell Tissue Type: Human Brain Organoid
CL594 TBR1 Antibody Immunofluorescence validation (1/50, 1/200, 1/500 dilution) in Human Brain Organoid (Cat no:CL594-20932)
Loading...
||
New chat Able
正在加载,请稍候...