Use Able AI chat for product recommendations

CoraLite®594-conjugated TBR1 Polyclonal antibody

TBR1 Polyclonal Antibody for IF-P

Cat No. CL594-20932

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

T box brain protein 1, T box, brain, 1, T brain 1, TBR 1, TBR1, TES 56

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-20932 targets TBR1 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14935

Product name: Recombinant human TBR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-196 aa of BC104844

Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQ

Predict reactive species
Full Name T-box, brain, 1
Calculated Molecular Weight 682 aa, 74 kDa
Observed Molecular Weight 74 kDa
GenBank Accession NumberBC104844
Gene Symbol TBR1
Gene ID (NCBI) 10716
RRIDAB_2919857
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16650
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TBR1, also named as T-box brain protein 1, is a 682 amino acid protein, which contains one T-box DNA-binding domain and localizes in the nucleus. TBR1 is expressed in the brain and as a transcriptional regulator is involved in developmental processes. TBR1 is required for normal brain development.

Protocols

Product Specific Protocols
IF protocol for CL594 TBR1 antibody CL594-20932Download protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Etienne (Verified Customer) (12-19-2022)

Worked great. Very crisp staining with absolutely no noise. Definitely doing to use again. I found the best dilution to be 1/200

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/50, 1/200, 1/500
  • Cell Tissue Type: Human Brain Organoid
CL594 TBR1 Antibody Immunofluorescence validation (1/50, 1/200, 1/500 dilution) in Human Brain Organoid (Cat no:CL594-20932)
Loading...
||
New chat

Able

正在加载,请稍候...