TNFRSF9/CD137 Recombinant monoclonal antibody, PBS Only

• 

TNFRSF9/CD137 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83893-3-PBS

Clone No.241006F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

TNFRSF9, 4 1BB, 4 1BB ligand receptor, 4-1BB ligand receptor, CD137

---

Product Information

83893-3-PBS targets TNFRSF9/CD137 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0016

  Product name: Recombinant Human TNFRSF9/CD137 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 24-186 aa of BC006196

  Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

• Full Name: tumor necrosis factor receptor superfamily, member 9
• Calculated Molecular Weight: 28 kDa
• GenBank Accession Number: BC006196
• Gene Symbol: TNFRSF9/CD137
• Gene ID (NCBI): 3604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07011
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.