CoraLite® Plus 488-conjugated TOM20 Recombinant monoclonal antibody

TOM20 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-80501
Clone No.1D22

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig, chicken, zebrafish

Applications

IF/ICC, FC (Intra)

TOMM20, 1D22, KIAA0016, MAS20, MOM19

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-80501 targets TOM20 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig, chicken, zebrafish samples.

Tested Reactivity human, mouse, rat, pig, chicken, zebrafish
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2378

Product name: Recombinant human TOM20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-145 aa of BC000882

Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Predict reactive species
Full Name translocase of outer mitochondrial membrane 20 homolog (yeast)
Calculated Molecular Weight 145 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC000882
Gene Symbol TOM20
Gene ID (NCBI) 9804
RRIDAB_2923885
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15388
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TOM20, also named as KIAA0016, belongs to the Tom20 family. It is a central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22, TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. TOM20 is characterized as major docking receptors to mediate the recognition by different mechanisms.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TOM20 antibody CL488-80501Download protocol
IF protocol for CL Plus 488 TOM20 antibody CL488-80501Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...