TRIM21 Monoclonal antibody

• 

  WB analysis using 67136-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67136-1-Ig (TRIM21 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of HeLa using 67136-1-Ig

  WB result of TRIM21 antibody (67136-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRIM21 transfected HeLa cells.

• 

  WB analysis of NIH/3T3 using 67136-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67136-1-Ig (TRIM21 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67136-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67136-1-Ig (TRIM21 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 67136-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67136-1-Ig (TRIM21 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 67136-1-Ig

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67136-1-Ig (TRIM21 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 67136-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67136-1-Ig (TRIM21 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 67136-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67136-1-Ig (TRIM21 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 67136-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67136-1-Ig (TRIM21 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 67136-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67136-1-Ig (TRIM21 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67136-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67136-1-Ig (TRIM21 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67136-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TRIM21 antibody (67136-1-Ig, Clone: 1E8B9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

This TRIM21 antibody (67136-1-Ig) is a mouse monoclonal antibody that targets TRIM21 in WB, IHC, IF/ICC, ELISA and is suitable for human, mouse, rat samples. The 67136-1-Ig antibody has 18 publication citations.

Cat No. 67136-1-Ig

Clone No.1E8B9

Publications(18)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

1E8B9, 52 kDa ribonucleoprotein autoantigen Ro/SS-A, E3 ubiquitin-protein ligase TRIM21, EC:2.3.2.27, RING finger protein 81

---

Tested Applications

• Positive WB detected in: HeLa cells, HL-60 cells, HSC-T6 cells, Jurkat cells, NIH/3T3 cells, NCI-H1299 cells, HepG2 cells, PC-12 cells
• Positive IHC detected in: human breast cancer tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 15 publications below
• IHC: See 1 publications below
• IF: See 4 publications below
• IP: See 2 publications below
• CoIP: See 3 publications below

Product Information

67136-1-Ig targets TRIM21 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28377

  Product name: Recombinant human TRIM21 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 176-475 aa of BC010861

  Sequence: SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY

• Full Name: tripartite motif-containing 21
• Calculated Molecular Weight: 475 aa, 54 kDa
• Observed Molecular Weight: 42-54 kDa
• GenBank Accession Number: BC010861
• Gene Symbol: TRIM21
• Gene ID (NCBI): 6737
• RRID: AB_2882435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P19474
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM21 has multiple N-terminal zinc finger motifs(has E3 ligase activity), a central leucine zipper, and a potential N-glycosylation site. TRIM21 is a E3 ubiquitin-protein ligase. It can form a ubiquitin ligase complex with E2 UBE2D2, which function not only for the uniquitination of USP4 and IKBKB but also for its self-ubiquitination. It has a role in the regulation of the cell cycle progression and could enhance the decapping activity of DCP2. It can exist in all mammalian cells as a ribonucleoprotein particle , which composed of a single polypeptide and 1 of 4 small RNA molecules. TRIM21 exists various isoforms and range molecular weight of isoforms is about 42-45kDa and 49-54 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; Stress granule homeostasis is modulated by TRIM21-mediated ubiquitination of G3BP1 and autophagy-dependent elimination of stress granules; Authors - Cuiwei Yang ; KD Validated
human	WB	J Transl Med; TC2N inhibits distant metastasis and stemness of breast cancer via blocking fatty acid synthesis; Authors - Xiang-Lin Hao
human	WB	Int J Mol Sci; TRIM21 Promotes Rabies Virus Production by Degrading IRF7 through Ubiquitination; Authors - Boyue Zhang ; KD Validated
mouse	WB	Int Immunopharmacol; TRIM21 deficiency confers protection from OGD/R-induced oxidative and inflammatory damage in cultured hippocampal neurons through regulation of the Keap1/Nrf2 pathway.; Authors - Yahong Fu ; KD Validated
human	WB,IP	Cell Death Dis; RPRD1A stabilizes NRF2 and aggravates HCC progression through competing with p62 for TRIM21 binding.; Authors - Xiaofan Feng
human	WB	JCI Insight; Alternative exon usage in TRIM21 determines the antigenicity of Ro52/TRIM21 in systemic lupus erythematosus; Authors - Eduardo Gomez-Bañuelos