Tested Applications
| Positive WB detected in | HeLa cells, HL-60 cells, HSC-T6 cells, Jurkat cells, NIH/3T3 cells, NCI-H1299 cells, HepG2 cells, PC-12 cells |
| Positive IHC detected in | human breast cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 16 publications below |
| IHC | See 1 publications below |
| IF | See 4 publications below |
| IP | See 2 publications below |
| CoIP | See 3 publications below |
Product Information
67136-1-Ig targets TRIM21 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28377 Product name: Recombinant human TRIM21 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 176-475 aa of BC010861 Sequence: SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY Predict reactive species |
| Full Name | tripartite motif-containing 21 |
| Calculated Molecular Weight | 475 aa, 54 kDa |
| Observed Molecular Weight | 42-54 kDa |
| GenBank Accession Number | BC010861 |
| Gene Symbol | TRIM21 |
| Gene ID (NCBI) | 6737 |
| RRID | AB_2882435 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P19474 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM21 has multiple N-terminal zinc finger motifs(has E3 ligase activity), a central leucine zipper, and a potential N-glycosylation site. TRIM21 is a E3 ubiquitin-protein ligase. It can form a ubiquitin ligase complex with E2 UBE2D2, which function not only for the uniquitination of USP4 and IKBKB but also for its self-ubiquitination. It has a role in the regulation of the cell cycle progression and could enhance the decapping activity of DCP2. It can exist in all mammalian cells as a ribonucleoprotein particle , which composed of a single polypeptide and 1 of 4 small RNA molecules. TRIM21 exists various isoforms and range molecular weight of isoforms is about 42-45kDa and 49-54 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRIM21 antibody 67136-1-Ig | Download protocol |
| IHC protocol for TRIM21 antibody 67136-1-Ig | Download protocol |
| WB protocol for TRIM21 antibody 67136-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Autophagy Stress granule homeostasis is modulated by TRIM21-mediated ubiquitination of G3BP1 and autophagy-dependent elimination of stress granules
| ||
J Transl Med TC2N inhibits distant metastasis and stemness of breast cancer via blocking fatty acid synthesis | ||
Int J Mol Sci TRIM21 Promotes Rabies Virus Production by Degrading IRF7 through Ubiquitination
| ||
Int Immunopharmacol TRIM21 deficiency confers protection from OGD/R-induced oxidative and inflammatory damage in cultured hippocampal neurons through regulation of the Keap1/Nrf2 pathway.
| ||
Cell Death Dis RPRD1A stabilizes NRF2 and aggravates HCC progression through competing with p62 for TRIM21 binding. | ||
JCI Insight Alternative exon usage in TRIM21 determines the antigenicity of Ro52/TRIM21 in systemic lupus erythematosus |























