• Featured Product
  • KD/KO Validated

TRIM21 Monoclonal antibody, PBS Only (Capture)

TRIM21 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 67136-1-PBS
Clone No.1E8B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

1E8B9, 52 kDa ribonucleoprotein autoantigen Ro/SS-A, E3 ubiquitin-protein ligase TRIM21, EC:2.3.2.27, RING finger protein 81

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67136-1-PBS targets TRIM21 as part of a matched antibody pair:

MP50371-2: 67136-1-PBS capture and 67136-3-PBS detection (validated in Cytometric bead array)

MP50371-4: 67136-1-PBS capture and 67136-5-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28377

Product name: Recombinant human TRIM21 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 176-475 aa of BC010861

Sequence: SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY

Predict reactive species
Full Name tripartite motif-containing 21
Calculated Molecular Weight 475 aa, 54 kDa
Observed Molecular Weight42-54 kDa
GenBank Accession NumberBC010861
Gene Symbol TRIM21
Gene ID (NCBI) 6737
RRIDAB_2882435
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP19474
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TRIM21 has multiple N-terminal zinc finger motifs(has E3 ligase activity), a central leucine zipper, and a potential N-glycosylation site. TRIM21 is a E3 ubiquitin-protein ligase. It can form a ubiquitin ligase complex with E2 UBE2D2, which function not only for the uniquitination of USP4 and IKBKB but also for its self-ubiquitination. It has a role in the regulation of the cell cycle progression and could enhance the decapping activity of DCP2. It can exist in all mammalian cells as a ribonucleoprotein particle , which composed of a single polypeptide and 1 of 4 small RNA molecules. TRIM21 exists various isoforms and range molecular weight of isoforms is about 42-45kDa and 49-54 kDa.

Loading...
||
New chat Able
正在加载,请稍候...