Product Information
66750-1-PBS targets TSH Beta in IHC, IF-P, Indirect ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27153 Product name: Recombinant human TSHB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 65-138 aa of BC069298 Sequence: YALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV Predict reactive species |
Full Name | thyroid stimulating hormone, beta |
Calculated Molecular Weight | 138 aa, 16 kDa |
GenBank Accession Number | BC069298 |
Gene Symbol | TSH beta |
Gene ID (NCBI) | 7252 |
RRID | AB_2882097 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P01222 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |