TSH Beta Monoclonal antibody, PBS Only

• 

  IHC staining of human pituitary using 66750-1-Ig (same clone as 66750-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 66750-1-Ig (TSH beta antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66750-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary using 66750-1-Ig (same clone as 66750-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 66750-1-Ig (TSH beta antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66750-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human pituitary using 66750-1-Ig (same clone as 66750-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human pituitary tissue using TSH Beta antibody (66750-1-Ig, Clone: 2G1H3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66750-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human pituitary using 66750-1-Ig (same clone as 66750-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human pituitary tissue using TSH Beta antibody (66750-1-Ig, Clone: 2G1H3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66750-1-PBS in a different storage buffer formulation.

TSH Beta Monoclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 66750-1-PBS

Clone No.2G1H3

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IHC, IF-P, Indirect ELISA

Synonyms

CHNG4, Thyrotropin alfa, Thyrotropin beta chain, Thyrotropin subunit beta, TSH B, TSH BETA, TSHB

---

Product Information

66750-1-PBS targets TSH Beta in IHC, IF-P, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27153

  Product name: Recombinant human TSHB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 65-138 aa of BC069298

  Sequence: YALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV

• Full Name: thyroid stimulating hormone, beta
• Calculated Molecular Weight: 138 aa, 16 kDa
• GenBank Accession Number: BC069298
• Gene Symbol: TSH beta
• Gene ID (NCBI): 7252
• RRID: AB_2882097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01222
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.