Tested Applications
| Positive IHC detected in | human pituitary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human pituitary tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:3000-1:12000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
66750-1-Ig targets TSH Beta in IHC, IF-P, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27153 Product name: Recombinant human TSHB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 65-138 aa of BC069298 Sequence: YALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV Predict reactive species |
| Full Name | thyroid stimulating hormone, beta |
| Calculated Molecular Weight | 138 aa, 16 kDa |
| GenBank Accession Number | BC069298 |
| Gene Symbol | TSH beta |
| Gene ID (NCBI) | 7252 |
| RRID | AB_2882097 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01222 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TSH Beta antibody 66750-1-Ig | Download protocol |
| IHC protocol for TSH Beta antibody 66750-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







