TSH Beta Monoclonal antibody

• 

  IHC staining of human pituitary using 66750-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 66750-1-Ig (TSH beta antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary using 66750-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 66750-1-Ig (TSH beta antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human pituitary using 66750-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human pituitary tissue using TSH Beta antibody (66750-1-Ig, Clone: 2G1H3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human pituitary using 66750-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human pituitary tissue using TSH Beta antibody (66750-1-Ig, Clone: 2G1H3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

TSH Beta Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 66750-1-Ig

Clone No.2G1H3

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

Human and More (1)

Applications

IHC, IF-P, ELISA

Synonyms

CHNG4, Thyrotropin alfa, Thyrotropin beta chain, Thyrotropin subunit beta, TSH B, TSH BETA, TSHB

---

Tested Applications

• Positive IHC detected in: human pituitary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human pituitary tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:3000-1:12000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

66750-1-Ig targets TSH Beta in IHC, IF-P, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27153

  Product name: Recombinant human TSHB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 65-138 aa of BC069298

  Sequence: YALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV

• Full Name: thyroid stimulating hormone, beta
• Calculated Molecular Weight: 138 aa, 16 kDa
• GenBank Accession Number: BC069298
• Gene Symbol: TSH beta
• Gene ID (NCBI): 7252
• RRID: AB_2882097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01222
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,IF	Cancer Commun (Lond); Local TSH/TSHR signaling promotes CD8+ T cell exhaustion and immune evasion in colorectal carcinoma; Authors - Sisi Zeng