TSH Beta Monoclonal antibody

• Home
• Products
• Primary Antibodies
• TSH Beta Monoclonal antibody (66750-1-Ig)

TSH Beta Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66750-1-Ig Copied!

Clone No. 2G1H3

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

TSHB, 2G1H3, Thyroid-stimulating hormone subunit beta, Thyrotropin alfa, Thyrotropin beta chain

• 

  WB analysis of rat pituitary gland using 66750-1-Ig

  rat pituitary gland tissue were subjected to SDS PAGE followed by western blot with 66750-1-Ig (TSH Beta antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pituitary using 66750-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 66750-1-Ig (TSH beta antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pituitary using 66750-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 66750-1-Ig (TSH beta antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human pituitary using 66750-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human pituitary tissue using TSH Beta antibody (66750-1-Ig, Clone: 2G1H3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human pituitary using 66750-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human pituitary tissue using TSH Beta antibody (66750-1-Ig, Clone: 2G1H3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TSH Beta in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat pituitary gland tissue
• Positive IHC detected in: human pituitary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human pituitary tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:3000-1:12000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66750-1-Ig targets TSH Beta in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27153

  Product name: Recombinant human TSHB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 65-138 aa of BC069298

  Sequence: YALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV

• Full Name: thyroid stimulating hormone, beta
• Calculated Molecular Weight: 138 aa, 16 kDa
• GenBank Accession Number: BC069298
• Gene Symbol: TSH beta
• Gene ID (NCBI): 7252
• RRID: AB_2882097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01222
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TSH Beta Monoclonal antibody (2G1H3), catalog number 66750-1-Ig, has 1 citation. It was used in a study published in Cancer Communications (2024) investigating local TSH/TSHR signaling's role in promoting CD8+ T cell exhaustion and immune evasion in colorectal carcinoma. The antibody was applied for IHC and IF in human samples, placing its research context within cancer immunology and tumor microenvironment studies.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,IF	Cancer Commun (Lond); Local TSH/TSHR signaling promotes CD8+ T cell exhaustion and immune evasion in colorectal carcinoma; Authors - Sisi Zeng