UBE2O Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87282-1-RR (same clone as 87282-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87282-1-RR (UBE2O antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87282-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87282-1-RR (same clone as 87282-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87282-1-RR (UBE2O antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87282-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 87282-1-RR (same clone as 87282-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using UBE2O antibody (87282-1-RR, Clone: 252545E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 87282-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87282-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87282-1-RR against Human UBE2O were performed. The affinity constant is 16.1 nM.

UBE2O Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87282-1-PBS

Clone No.252545E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

(E3-independent) E2 ubiquitin-conjugating enzyme, E2/E3 hybrid ubiquitin-protein ligase UBE2O, E2-230K, EC:2.3.2.24, KIAA1734

---

Product Information

87282-1-PBS targets UBE2O in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8580

  Product name: Recombinant human UBE2O protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-343 aa of BC007822

  Sequence: SSDSGPEAGSQRLLFSHDLVSGRYRGSVHFGLVRLIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGRASPLRRGYVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFFDDSYGFYPGQVLIGPAKIFSSVQWLSGVKPVLSTKSKFRVVVEEVQVVELKVTWITKSFCPGGTDSVSPPPSVITQENLGRVKRLGCFDHAQRQLGERCLYVFPAKVEPAKIAWECPEKNCAQGEGSMAKKVKRL

• Full Name: ubiquitin-conjugating enzyme E2O
• Calculated Molecular Weight: 1292 aa, 141 kDa
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: BC007822
• Gene Symbol: UBE2O
• Gene ID (NCBI): 63893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9C0C9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UBE2O, also named as KIAA1734, belongs to the ubiquitin-conjugating enzyme family. It catalyzes the covalent attachment of ubiquitin to other proteins. UBE2O has a calculated molecular mass of 141 kDa, and many bands can be detected as 140-170 kDa and 200-230 kDa (PMID: 28774900, 23455153, 28774922, 11311559).