CoraLite®594-conjugated USP7 Monoclonal antibody

• 

  IF Staining of HeLa using CL594-66514

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite®594 USP7 antibody (CL594-66514, Clone: 3D7D11 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL594-66514

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human USP7 (CL594-66514, Clone:3D7D11) (red), or 0.4 ug Mouse IgG2a Isotype Control (CL594-66360-2, Clone: K11A1B2A2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

USP7 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-66514

Clone No.3D7D11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

3D7D11, HAUSP

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66514 targets USP7 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25652

  Product name: Recombinant human USP7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-93 aa of

  Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK

• Full Name: ubiquitin specific peptidase 7 (herpes virus-associated)
• Observed Molecular Weight: 128 kDa
• Gene Symbol: USP7
• Gene ID (NCBI): 7874
• RRID: AB_2934731
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q93009
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.