VEGF-C Monoclonal antibody

• 

  WB analysis of MCF-7 using 67116-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of T-47D using 67116-1-Ig

  T-47D cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 67116-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCI-H1299 using 67116-1-Ig

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 67116-1-Ig

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of T-47D using 67116-1-Ig

  T-47D cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 67116-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 67116-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using VEGFC antibody (67116-1-Ig, Clone: 2B11F7 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

VEGF-C Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67116-1-Ig

Clone No.2B11F7

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

VEGFC, 2B11F7, vascular endothelial growth factor C, Vascular endothelial growth factor-related protein, VEGF C

---

Tested Applications

• Positive WB detected in: MCF-7 cells, T-47D cells, NCI-H1299 cells, A549 cells, LNCaP cells, HT-1080 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67116-1-Ig targets VEGF-C in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18182

  Product name: Recombinant human VEGFC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 179-228 aa of BC035212

  Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS

• Full Name: vascular endothelial growth factor C
• Calculated Molecular Weight: 419 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC035212
• Gene Symbol: VEGFC
• Gene ID (NCBI): 7424
• RRID: AB_2882420
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49767
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Cycle; CircHGS enhances the progression of bladder cancer by regulating the miR-513a-5p/VEGFC axis and activating the AKT/mTOR signaling pathway; Authors - Yi Zhu