VEGF-C Monoclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 67116-1-Ig (same clone as 67116-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67116-1-PBS in a different storage buffer formulation.

• 

  WB analysis of T-47D using 67116-1-Ig (same clone as 67116-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67116-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 67116-1-Ig (same clone as 67116-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67116-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCI-H1299 using 67116-1-Ig (same clone as 67116-1-PBS)

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67116-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 67116-1-Ig (same clone as 67116-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67116-1-PBS in a different storage buffer formulation.

• 

  WB analysis of T-47D using 67116-1-Ig (same clone as 67116-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67116-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 67116-1-Ig (same clone as 67116-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 67116-1-Ig (VEGFC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67116-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 67116-1-Ig (same clone as 67116-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using VEGFC antibody (67116-1-Ig, Clone: 2B11F7 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67116-1-PBS in a different storage buffer formulation.

VEGF-C Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67116-1-PBS

Clone No.2B11F7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

VEGFC, 2B11F7, vascular endothelial growth factor C, Vascular endothelial growth factor-related protein, VEGF C

---

Product Information

67116-1-PBS targets VEGF-C in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18182

  Product name: Recombinant human VEGFC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 179-228 aa of BC035212

  Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS

• Full Name: vascular endothelial growth factor C
• Calculated Molecular Weight: 419 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC035212
• Gene Symbol: VEGFC
• Gene ID (NCBI): 7424
• RRID: AB_2882420
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49767
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.