CoraLite® Plus 488-conjugated VEGF-C Monoclonal antibody

VEGF-C Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67116
Clone No.2B11F7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

VEGFC, 2B11F7, vascular endothelial growth factor C, Vascular endothelial growth factor-related protein, VEGF C

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67116 targets VEGF-C in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18182

Product name: Recombinant human VEGFC protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 179-228 aa of BC035212

Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS

Predict reactive species
Full Name vascular endothelial growth factor C
Calculated Molecular Weight 419 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC035212
Gene Symbol VEGFC
Gene ID (NCBI) 7424
RRIDAB_3672937
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49767
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 VEGF-C antibody CL488-67116Download protocol
IF protocol for CL Plus 488 VEGF-C antibody CL488-67116Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...