Tested Applications
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL555-67610 targets VPS53 in IF/ICC applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29875 Product name: Recombinant human VPS53 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-128 aa of BC029560 Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL Predict reactive species |
| Full Name | vacuolar protein sorting 53 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 832 aa, 94 kDa |
| Observed Molecular Weight | 94 kDa |
| GenBank Accession Number | BC029560 |
| Gene Symbol | VPS53 |
| Gene ID (NCBI) | 55275 |
| RRID | AB_2934684 |
| Conjugate | CoraLite®555 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 557 nm / 570nm |
| Excitation Laser | Green Laser (532 nm), Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q5VIR6 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
VPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL555 VPS53 antibody CL555-67610 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

