• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated WFS1 Polyclonal antibody

WFS1 Polyclonal Antibody for IF-P

Cat No. CL488-26995

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

FLJ51211, WFRS, WFS, WFS1, Wolfram syndrome 1 (wolframin), WOLFRAMIN

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inrat brain tissue, mouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26995 targets WFS1 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25724

Product name: Recombinant human WFS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-95 aa of BC030130

Sequence: MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERA

Predict reactive species
Full Name Wolfram syndrome 1 (wolframin)
Calculated Molecular Weight 890 aa, 100 kDa
GenBank Accession NumberBC030130
Gene Symbol WFS1
Gene ID (NCBI) 7466
RRIDAB_3084104
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO76024
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Wolfram syndrome protein (WFS1), also called wolframin, is a transmembrane protein, which is located primarily in the endoplasmic reticulum and its expression is induced in response to ER stress, partially through transcriptional activation. ER localization suggests that WFS1 protein has physiological functions in membrane trafficking, secretion, processing and/or regulation of ER calcium homeostasis. It is ubiquitously expressed with highest levels in brain, pancreas, heart, and insulinoma beta-cell lines. Mutations of the WFS1 gene are responsible for two hereditary diseases, autosomal recessive Wolfram syndrome and autosomal dominant low frequency sensorineural hearing loss.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 WFS1 antibody CL488-26995Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...