Product Information
CL488-25997 targets XBP-1U specific in applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21714 Product name: Recombinant human XBP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 167-261 aa of BC000938 Sequence: LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN Predict reactive species |
| Full Name | X-box binding protein 1 |
| Calculated Molecular Weight | 261 aa, 29 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC000938 |
| Gene Symbol | XBP1 |
| Gene ID (NCBI) | 7494 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17861 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
X-box-binding protein 1 (XBP1), also named as TREB5, is a 261 amino acid protein, which contains one bZIP domain and belongs to the bZIP family. XBP1 localizes in the nucleus and as a transcription factor is essential for hepatocyte growth, the differentiation of plasma cells, the immunoglobulin secretion, and the unfolded protein response. XBP1 has an association with major affective disorder. The molecular weight of protein generated from the spliced XBP1 mRNA is 54 kDa and protein generated from unspliced Xbp1 mRNA is 33 kDa.
