• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated XBP-1U specific Polyclonal antibody

XBP-1U specific Polyclonal Antibody for
Cat No. CL488-25997

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

TREB5, X box binding protein 1, XBP 1, XBP1, XBP1s, XBP-1S, XBP1U, XBP-1U specific, XBP2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-25997 targets XBP-1U specific in applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21714

Product name: Recombinant human XBP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 167-261 aa of BC000938

Sequence: LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN

Predict reactive species
Full Name X-box binding protein 1
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC000938
Gene Symbol XBP1
Gene ID (NCBI) 7494
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17861
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

X-box-binding protein 1 (XBP1), also named as TREB5, is a 261 amino acid protein, which contains one bZIP domain and belongs to the bZIP family. XBP1 localizes in the nucleus and as a transcription factor is essential for hepatocyte growth, the differentiation of plasma cells, the immunoglobulin secretion, and the unfolded protein response. XBP1 has an association with major affective disorder. The molecular weight of protein generated from the spliced XBP1 mRNA is 54 kDa and protein generated from unspliced Xbp1 mRNA is 33 kDa.

Loading...
||
New chat Able
正在加载,请稍候...