Tested Applications
| Positive WB detected in | A549 cells, HepG2 cells, HeLa cells, LNCaP cells, A431 cells, HSC-T6 cells, PC-12 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67196-1-Ig targets YES1 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples.
| Tested Reactivity | Human, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5016 Product name: Recombinant human YES1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 275-526 aa of BC048960 Sequence: ESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFL Predict reactive species |
| Full Name | v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | BC048960 |
| Gene Symbol | YES1 |
| Gene ID (NCBI) | 7525 |
| RRID | AB_2918483 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P07947 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YES1, also named as p61-Yes and YES, belongs to the protein kinase superfamily, Tyr protein kinase family and SRC subfamily. It promotes infectivity of Neisseria gonorrhoeae in epithelial cells by phosphorylating MCP/CD46. YES1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for YES1 antibody 67196-1-Ig | Download protocol |
| WB protocol for YES1 antibody 67196-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







