• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated YES1 Monoclonal antibody

YES1 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67196
Clone No.1A12E7

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

FC (Intra)

1A12E7, c yes, EC:2.7.10.2, HsT441, P61 YES

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67196 targets YES1 in FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5016

Product name: Recombinant human YES1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 275-526 aa of BC048960

Sequence: ESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFL

Predict reactive species
Full Name v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
Calculated Molecular Weight 61 kDa
Observed Molecular Weight 62 kDa
GenBank Accession NumberBC048960
Gene Symbol YES1
Gene ID (NCBI) 7525
RRIDAB_2923764
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07947
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

YES1, also named as p61-Yes and YES, belongs to the protein kinase superfamily, Tyr protein kinase family and SRC subfamily. It promotes infectivity of Neisseria gonorrhoeae in epithelial cells by phosphorylating MCP/CD46. YES1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 YES1 antibody CL488-67196Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...