Tested Applications
| Positive IF-P detected in | mouse small intestine tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-67389 targets ZG16 in IF-P applications and shows reactivity with Human, mouse, pig, rat samples.
| Tested Reactivity | Human, mouse, pig, rat | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag11332 Product name: Recombinant human ZG16 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-167 aa of BC029149 Sequence: MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC Predict reactive species | 
                                    
| Full Name | zymogen granule protein 16 homolog (rat) | 
| Calculated Molecular Weight | 167 aa, 18 kDa | 
| Observed Molecular Weight | 16 kDa | 
| GenBank Accession Number | BC029149 | 
| Gene Symbol | ZG16 | 
| Gene ID (NCBI) | 653808 | 
| RRID | AB_3084764 | 
| Conjugate | CoraLite® Plus 594 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 594 nm / 615 nm | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | O60844 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Zymogen granule protein 16 (ZG16) has a Jacalin-like lectin domain, which is mainly expressed by mucus-secreting cells, including goblet cells in the intestine. It's reported that ZG16 expression was significantly decreased in colorectal cancer compared to normal tissue. ZG16 gene expression and copy number variations (CNV) were associated with multiple molecular and clinicopathological features of CRC including MSI, MLH1 silencing and so on. It's found that ZG16 is negatively correlated with lymphatic invasive and distant metastasis. Besides, overexpression of ZG16 blocks PD-L1 expression in colorectal cancer, and promotes NK cells survival and proliferation. Very importantly, ZG16 suppresses colorectal tumor growth via the immune system. (PMID: 33360840, 21893569)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 594 ZG16 antibody CL594-67389 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 



