CoraLite® Plus 594-conjugated ZG16 Monoclonal antibody

ZG16 Monoclonal Antibody for IF-P
Cat No. CL594-67389
Clone No.1A7B9

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig, rat

Applications

IF-P

FLJ43571, FLJ92276, hZG16, JCLN, JCLN1, Secretory lectin ZG16, ZG16, ZG16A, Zymogen granule protein 16

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse small intestine tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67389 targets ZG16 in IF-P applications and shows reactivity with Human, mouse, pig, rat samples.

Tested Reactivity Human, mouse, pig, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11332

Product name: Recombinant human ZG16 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-167 aa of BC029149

Sequence: MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC

Predict reactive species
Full Name zymogen granule protein 16 homolog (rat)
Calculated Molecular Weight 167 aa, 18 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC029149
Gene Symbol ZG16
Gene ID (NCBI) 653808
RRIDAB_3084764
Conjugate CoraLite® Plus 594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths594 nm / 615 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO60844
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Zymogen granule protein 16 (ZG16) has a Jacalin-like lectin domain, which is mainly expressed by mucus-secreting cells, including goblet cells in the intestine. It's reported that ZG16 expression was significantly decreased in colorectal cancer compared to normal tissue. ZG16 gene expression and copy number variations (CNV) were associated with multiple molecular and clinicopathological features of CRC including MSI, MLH1 silencing and so on. It's found that ZG16 is negatively correlated with lymphatic invasive and distant metastasis. Besides, overexpression of ZG16 blocks PD-L1 expression in colorectal cancer, and promotes NK cells survival and proliferation. Very importantly, ZG16 suppresses colorectal tumor growth via the immune system. (PMID: 33360840, 21893569)

Protocols

Product Specific Protocols
IF protocol for CL Plus 594 ZG16 antibody CL594-67389Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...