• Featured Product
  • KD/KO Validated

ZO-1 Polyclonal antibody

ZO-1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-Fro, FC (Intra), IP, ELISA

Cat No. 21773-1-AP
Publications(1762)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine, hamster and More (5)

Applications

WB, IHC, IF/ICC, IF-Fro, FC (Intra), IP, CoIP, RIP, ELISA

TJP1, Tight junction protein 1, Tight junction protein ZO 1, Tight junction protein ZO-1, ZO 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HEK-293 cells, NIH/3T3 cells, Caco-2 cells, HT-29 cells, HUVEC cells, HeLa cells, HepG2 cells, K-562 cells, MCF-7 cells, mouse brain tissue, rat brain tissue, Neuro-2a cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-Fro detected inmouse brain tissue
Positive IF/ICC detected inMCF-7 cells, MDCK cells, HUVEC cells
Positive FC (Intra) detected inMCF-7 cells

Freshly prepared samples are recommended.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:100-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21773-1-AP targets ZO-1 in WB, IHC, IF/ICC, IF-Fro, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, canine, hamster samples.

Tested Reactivity human, mouse, rat, canine, hamster
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, chicken, bovine, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16454

Product name: Recombinant human ZO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1446-1748 aa of BC111712

Sequence: SLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYPQKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF

Predict reactive species
Full Name tight junction protein 1 (zona occludens 1)
Calculated Molecular Weight 1748 aa, 195 kDa
Observed Molecular Weight 230 kDa
GenBank Accession NumberBC111712
Gene Symbol ZO-1
Gene ID (NCBI) 7082
RRIDAB_10733242
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07157
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

What is the function of ZO-1?

Zona Occludens 1 (ZO-1) is a tight junction (TJ) protein found in complexes at cell-cell contacts. The role of ZO-1 is to recruit other TJ proteins.1,2 The resulting TJ complexes regulate paracellular flow, contribute to apical-basal polarity, and are part of signaling pathways for proliferation and differentiation.3 This protein is useful for highlighting cell-cell contacts both in cultured cells and in tissue samples, outlining cell membranes and specific structures.

 

Where is ZO-1 expressed?

The protein is localized to the cytoplasmic membrane in most types of cells, particularly where a barrier function is essential. It is common in endothelial cells,4 which line the internal surface of blood and lymph vessels, and in epithelial cells,5 which form the outer barrier of organs.

ZO-1 is expressed in many tissues including the intestine, kidney, liver, and skeletal muscle cells.

 

What proteins does ZO-1 interact with?

ZO-1 contains multiple distinct protein domains that allow bind to other junctional proteins at the cytoplasmic membrane. The N-terminal of ZO-1 can dimerize with other ZO proteins and bind directly to other TJ proteins including claudins, connexions, and JAMs,6-10 which allows it to assemble TJ complexes. The C-terminal can interact with actin and cortactin, anchoring the TJ complexes to the cytoskeleton.8,11 This suggests that ZO-1 forms a link between the outer cell-cell contacts and the inner actin.


What is the molecular weight of ZO-1?

ZO-1 has an apparent molecular weight of 210-225 kDa. There are two isoforms of ZO-1, α+ and α-, which are produced by alternative RNA splicing and differ in the presence or absence of an internal 80-amino acid domain12,13. In some literature, the bands with a molecular weight of 250-260 kDa can also be detected for ZO-114,15,16,17.

 

1. McNeil, E., Capaldo, C. T. & Macara, I. G. Zonula occludens-1 function in the assembly of tight junctions in Madin-Darby canine kidney epithelial cells. Mol. Biol. Cell 17, 1922-32 (2006).

2. Kratzer, I. et al. Complexity and developmental changes in the expression pattern of claudins at the blood-CSF barrier. Histochem. Cell Biol. (2012). doi:10.1007/s00418-012-1001-9

3. Guillemot, L., Paschoud, S., Pulimeno, P., Foglia, A. & Citi, S. The cytoplasmic plaque of tight junctions: A scaffolding and signalling center. Biochim. Biophys. Acta - Biomembr. 1778, 601-613 (2008).

4. Tornavaca, O. et al. ZO-1 controls endothelial adherens junctions, cell-cell tension, angiogenesis, and barrier formation. J. Cell Biol. 208, 821-38 (2015).

5. Umeda, K. et al. Establishment and characterization of cultured epithelial cells lacking expression of ZO-1. J. Biol. Chem. 279, 44785-94 (2004).

6. Stevenson, B. R. Identification of ZO-1: a high molecular weight polypeptide associated with the tight junction (zonula occludens) in a variety of epithelia. J. Cell Biol. 103, 755-766 (1986).

7. Itoh, M. et al. Direct Binding of Three Tight Junction-Associated Maguks, Zo-1, Zo-2, and Zo-3, with the Cooh Termini of Claudins. J. Cell Biol. 147, 1351-1363 (1999).

8. Fanning, A. S., Jameson, B. J., Jesaitis, L. A. & Anderson, J. M. The Tight Junction Protein ZO-1 Establishes a Link between the Transmembrane Protein Occludin and the Actin Cytoskeleton. J. Biol. Chem. 273, 29745-29753 (1998).

9. Kausalya, P. J., Reichert, M. & Hunziker, W. Connexin45 directly binds to ZO-1 and localizes to the tight junction region in epithelial MDCK cells. FEBS Lett. 505, 92-96 (2001).

10.  Itoh, M. et al. Junctional adhesion molecule (JAM) binds to PAR-3. J. Cell Biol. 154, 491-498 (2001).

11. Itoh, M., Nagafuchi, A., Moroi, S. & Tsukita, S. Involvement of ZO-1 in Cadherin-based Cell Adhesion through Its Direct Binding to α Catenin and Actin Filaments. J. Cell Biol. 138, 181-192 (1997).  
12. Balda MS, Anderson JM. Two classes of tight junctions are revealed by ZO-1 isoforms. Am J Physiol264, (4 Pt 1):C918-24 (1993).

13. Sheth B, Fesenko I, Collins JE, Moran B, Wild AE, Anderson JM, Fleming TP. Tight junction assembly during mouse blastocyst formation is regulated by late expression of ZO-1 alpha+ isoform. Development. 124, (10):2027-37(1997).
14. Lassiter R, Merchen TD, Fang X, Wang Y. Protective Role of Kynurenine 3-Monooxygenase in Allograft Rejection and Tubular Injury in Kidney Transplantation. Front Immunol. 7, 12:671025 (2021). 

15. Rempe RG, Hartz AMS, Soldner ELB, Sokola BS, Alluri SR, Abner EL, Kryscio RJ, Pekcec A, Schlichtiger J, Bauer B. Matrix Metalloproteinase-Mediated Blood-Brain Barrier Dysfunction in Epilepsy. J Neurosci. 2, 38(18):4301-4315 (2018).

16. Lin SC, Way EL. Effects of morphine and B-endorphin on Ca2+-ATPase activity of synaptic plasma membranes. NIDA Res Monogr. 75, 117-20(1986). 

17. Wu Z, Mirza H, Teo JD, Tan KS. Strain-dependent induction of human enterocyte apoptosis by blastocystis disrupts epithelial barrier and ZO-1 organization in a caspase 3- and 9-dependent manner. Biomed Res Int. 2014, 209163(2014).

Protocols

Product Specific Protocols
FC protocol for ZO-1 antibody 21773-1-APDownload protocol
IF protocol for ZO-1 antibody 21773-1-APDownload protocol
IHC protocol for ZO-1 antibody 21773-1-APDownload protocol
IP protocol for ZO-1 antibody 21773-1-APDownload protocol
WB protocol for ZO-1 antibody 21773-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Cell Metab

Ketogenic diet alleviates septic lung injury via microbial gut-lung axis

Authors - Mingyuan Wei
mouse

Am J Respir Crit Care Med

Ezrin, a Membrane Cytoskeleton Cross Linker Protein, as a Marker of Epithelial Damage in Asthma.

Authors - Man Jia
mouse,humanIHC,IF

Cell Metab

Gut microbiota modulate distal symmetric polyneuropathy in patients with diabetes

Authors - Junpeng Yang
humanIF

Cell Stem Cell

Human branching cholangiocyte organoids recapitulate functional bile duct formation.

Authors - Floris J M Roos
IF

Nat Commun

Calcium transients regulate the apical emergence of basally located progenitors during Xenopus skin development

Authors - Neophytos Christodoulou
IF

Microbiome

Arula-7 powder improves diarrhea and intestinal epithelial tight junction function associated with its regulation of intestinal flora in calves infected with pathogenic Escherichia coli O1

Authors - Hao Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lee (Verified Customer) (02-04-2026)

ZO-1 Polyclonal antibody has worked well in our study for immunostaining of ZO-1 on rd12 mcie in genome editing projects

  • Applications: Cell culture, Protein purification
FH

Emily (Verified Customer) (07-31-2025)

Worked well. Images looked good. Murine lung was paraffin fixed and antigen retrieval was conducted prior to the staining. Antibody was diluted 1:400 and incubated for 2hr in a humidity chamber in the dark.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: Paraffin fixed murine lung tissue
FH

Ling (Verified Customer) (10-09-2024)

I tried different antibody before I found this one. All didn't work, but this one works well.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Primary brain cells
FH

Natalia (Verified Customer) (07-10-2024)

Used the dilution recommended (1:2000) and did not work. Haven't had the chance to re-try yet

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Primary human endothelial cells
FH

Sarah (Verified Customer) (03-20-2024)

The antibody works perfect.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cryosections intestine
ZO-1 Antibody Immunofluorescence validation (1:1000 dilution) in Cryosections intestine (Cat no:21773-1-AP)
FH

Xie (Verified Customer) (10-26-2021)

Efficient Labelling from proteintech ZO1 Antibody

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:150
  • Cell Tissue Type: CaCo-2 cell line
ZO-1 Antibody Immunofluorescence validation (1:150 dilution) in CaCo-2 cell line (Cat no:21773-1-AP)
FH

Samuel (Verified Customer) (08-06-2021)

Clean and strong band at 220-230 kDa in WB (reducing and denaturing conditions). I used the antibody at a 1:2500 dilution in 5% milk, incubation overnight at 4 degrees Celsius. 30ug loaded per sample.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/2500
  • Cell Tissue Type: SH-SY5Y, HEPG2, HEK293. 30ug each
ZO-1 Antibody Western Blot validation (1/2500 dilution) in SH-SY5Y, HEPG2, HEK293. 30ug each (Cat no:21773-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...