CoraLite®594-conjugated Beta Actin Monoclonal antibody

Beta Actin Monoclonal Antibody for WB, IF/ICC

Cat No. CL594-60008
Clone No.7D2C10

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat, canine, zebrafish, plant

Applications

WB, IF/ICC

ACTB, Actin, bate actin, β actin, Actin cytoplasmic 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, HEK-293 cells
Positive IF/ICC detected inHeLa cells, MDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60008 targets Beta Actin in WB, IF/ICC applications and shows reactivity with human, mouse, rat, canine, zebrafish, plant samples.

Tested Reactivity human, mouse, rat, canine, zebrafish, plant
Cited Reactivityrat
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0297

Product name: Recombinant human beta actin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 14-167 aa of BC002409

Sequence: SGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE

Predict reactive species
Full Name actin, beta
Calculated Molecular Weight 375 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC002409
Gene Symbol Beta Actin
Gene ID (NCBI) 60
RRIDAB_2883409
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodCaprylic acid/ammonium sulfate precipitation
UNIPROT IDP60709
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Beta actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody is conjugated with CL594,Ex/Em 593 nm/614 nm.

Protocols

Product Specific Protocols
IF protocol for CL594 Beta Actin antibody CL594-60008Download protocol
WB protocol for CL594 Beta Actin antibody CL594-60008Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Sci Rep

Translational enhancement of target endogenous mRNA in mammalian cells using programmable RNA-binding pentatricopeptide repeat proteins

Authors - Ning Ping
ratWB

Neurosci Res

Hippocampal Warburg effect Mediates Hydrogen Sulfide-Ameliorated Diabetes-Associated Cognitive Dysfunction: Involving Promotion of Hippocampal Synaptic Plasticity

Authors - Run-Qi Li
IF

Proc Natl Acad Sci U S A

Multifunctional biomolecular corona-inspired nanoremediation of antibiotic residues

Authors - Jie Hou
WB

Aging Cell

CaMKIIα-TARPγ8 signaling mediates hippocampal synaptic impairment in aging

Authors - Zhao JianHua
Loading...
||
New chat

Able

正在加载,请稍候...