Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated c-Met (Cytoplasmic) Polyclonal antibody

c-Met (Cytoplasmic) Polyclonal Antibody for FC (Intra)

Cat No. CL488-25869

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

FC (Intra)

c-Met, MET, AUTS9, c Met, EC:2.7.10.1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25869 targets c-Met (Cytoplasmic) in FC (Intra) applications and shows reactivity with human, mouse, rat, canine samples.

Tested Reactivity human, mouse, rat, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23140

Product name: Recombinant human MET protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 965-1085 aa of BC130420

Sequence: GSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIG

Predict reactive species
Full Name met proto-oncogene (hepatocyte growth factor receptor)
Calculated Molecular Weight 1390 aa, 155 kDa
Observed Molecular Weight 145 kDa
GenBank Accession NumberBC130420
Gene Symbol MET
Gene ID (NCBI) 4233
RRIDAB_3084093
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08581
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

c-Met (also named as MET or HGFR) is a receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to HGF ligand. c-Met regulates many physiological processes including proliferation, scattering, morphogenesis and survival. The primary single chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide linked to form the mature receptor. Overexpression and/or mutation of c-Met has been reported in various human malignancies, including lung cancer, breast cancer, head and neck cancer, gastric cancer, colorectal cancer, bladder cancer, uterine cervix carcinoma, and esophageal carcinoma, c-Met could serve as an important therapeutic target (PMID: 26036285). The c-met receptor is a 190-kD glycoprotein consisting of a 145-kD membrane-spanning beta chain and a 50-kD alpha chain (PMID: 7806559). In Western blot, this antibody produces bands of unknown identity at 55 and 100 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 c-Met (Cytoplasmic) antibody CL488-25869Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...