cyclin B1 Monoclonal antibody

• 

  WB analysis using 67686-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67686-1-Ig (cyclin B1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67686-1-Ig

  WB result of cyclin B1 antibody (67686-1-Ig; 1:3200; incubated at room temperature for 1.5 hours) with sh-Control and sh-cyclin B1 transfected HeLa cells.

• 

  IHC staining of human tonsillitis using 67686-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67686-1-Ig (cyclin B1 antibody) at dilution of 1:1600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67686-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67686-1-Ig (cyclin B1 antibody) at dilution of 1:1600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skin using 67686-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 67686-1-Ig (cyclin B1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 67686-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using cyclin B1 antibody (67686-1-Ig, Clone: 1F3G11 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HeLa using 67686-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using cyclin B1 antibody (67686-1-Ig, Clone: 1F3G11 ) at dilution of 1:650 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HT-29 using 67686-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HT-29 cells using cyclin B1 antibody (67686-1-Ig, Clone: 1F3G11 ) at dilution of 1:650 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 67686-1-Ig

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug cyclin B1 Monoclonal antibody (67686-1-Ig, Clone:1F3G11)(red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

cyclin B1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 67686-1-Ig

Clone No.1F3G11

Publications(27)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

CCNB1, 1F3G11, CCNB, Cyclin B, G2/mitotic specific cyclin B1

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells, HSC-T6 cells, K-562 cells, Jurkat cells, HEK-293 cells
• Positive IHC detected in: human tonsillitis tissue, rat skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HT-29 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 27 publications below
• IF: See 1 publications below

Product Information

67686-1-Ig targets cyclin B1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29444

  Product name: Recombinant human CCNB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC006510

  Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE

• Full Name: cyclin B1
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC006510
• Gene Symbol: Cyclin B1
• Gene ID (NCBI): 891
• RRID: AB_2882879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P14635
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer; Authors - Rong Wang
human	WB	Ecotoxicol Environ Saf; The role of ER stress and ATP/AMPK in oxidative stress meditated hepatotoxicity induced by citrinin.; Authors - Jing Wu
mouse,human	WB,IF	Cell Signal; MicroRNA-30c-5p arrests bladder cancer G2/M phase and suppresses its progression by targeting PRC1-mediated blocking of CDK1/Cyclin B1 axis; Authors - Yining Hao
human	WB	Front Mol Biosci; Over-Expression and Prognostic Significance of FATP5, as a New Biomarker, in Colorectal Carcinoma.; Authors - Qi-Shun Geng
human	WB	Steroids; The location of estrogen receptor variant ER-α36 is associated with the invasion of glioblastoma; Authors - Hongyan Li
human	WB	Cell Biochem Biophys; Brucine Suppresses Malignant Progression of Prostate Cancer by Decreasing Sarcosine Accumulation via Downregulation of GNMT in the Glycine/sarcosine Metabolic Pathway; Authors - Long Miao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tsimafei (Verified Customer) (08-04-2024)

Multiple bands are detected on the membrane

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mESCs

cyclin B1 Antibody Western Blot validation (1:1000 dilution) in mESCs (Cat no:67686-1-Ig)