cyclin B1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67686-1-Ig (same clone as 67686-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67686-1-Ig (cyclin B1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67686-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67686-1-Ig (same clone as 67686-1-PBS)

  WB result of cyclin B1 antibody (67686-1-Ig; 1:3200; incubated at room temperature for 1.5 hours) with sh-Control and sh-cyclin B1 transfected HeLa cells. This data was developed using the same antibody clone with 67686-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67686-1-Ig (same clone as 67686-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67686-1-Ig (cyclin B1 antibody) at dilution of 1:1600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67686-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67686-1-Ig (same clone as 67686-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67686-1-Ig (cyclin B1 antibody) at dilution of 1:1600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67686-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skin using 67686-1-Ig (same clone as 67686-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 67686-1-Ig (cyclin B1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67686-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67686-1-Ig (same clone as 67686-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using cyclin B1 antibody (67686-1-Ig, Clone: 1F3G11 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67686-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67686-1-Ig (same clone as 67686-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using cyclin B1 antibody (67686-1-Ig, Clone: 1F3G11 ) at dilution of 1:650 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67686-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HT-29 using 67686-1-Ig (same clone as 67686-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HT-29 cells using cyclin B1 antibody (67686-1-Ig, Clone: 1F3G11 ) at dilution of 1:650 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67686-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67686-1-Ig (same clone as 67686-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug cyclin B1 Monoclonal antibody (67686-1-Ig, Clone:1F3G11)(red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67686-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

cyclin B1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 67686-1-PBS

Clone No.1F3G11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

CCNB1, 1F3G11, CCNB, Cyclin B, G2/mitotic specific cyclin B1

---

Product Information

67686-1-PBS targets cyclin B1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29444

  Product name: Recombinant human CCNB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC006510

  Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE

• Full Name: cyclin B1
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC006510
• Gene Symbol: Cyclin B1
• Gene ID (NCBI): 891
• RRID: AB_2882879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P14635
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.