CoraLite®555-conjugated cyclin B1 Monoclonal antibody

• 

  IF Staining of HeLa using CL555-67686

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®555 cyclin B1 antibody (CL555-67686, Clone: 1F3G11 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL555-67686

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®555 Anti-Human cyclin B1 (CL555-67686, Clone:1F3G11) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

cyclin B1 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL555-67686

Clone No.1F3G11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

CCNB1, G2/mitotic-specific cyclin-B1, G2/mitotic specific cyclin B1, Cyclin B, CCNB

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-67686 targets cyclin B1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29444

  Product name: Recombinant human CCNB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC006510

  Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE

• Full Name: cyclin B1
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC006510
• Gene Symbol: Cyclin B1
• Gene ID (NCBI): 891
• RRID: AB_2934686
• Conjugate: CoraLite®555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 557 nm / 570 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P14635
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.