mCherry Polyclonal antibody

mCherry Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 26765-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

recombinant protein and More (8)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Red fluorescence protein, red fluorescent protein, RFP, RFP-tag

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTransfected HEK-293 cells, Recombinant protein
Positive IP detected inTransfected HEK-293T cells
Positive IF/ICC detected inTransfected HEK-293 cells
Positive FC (Intra) detected inTransfected HEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26765-1-AP targets mCherry in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with recombinant protein samples.

Tested Reactivity recombinant protein
Cited Reactivityhuman, mouse, rabbit, monkey, zebrafish, yeast, plant, d. punctatus
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25320

Product name: Recombinant mCherry protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-235 aa of

Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Predict reactive species
Full Name mCherry
Calculated Molecular Weight 27 kDa
Gene Symbol
Gene ID (NCBI)
RRIDAB_2876881
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Red fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages.

The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm).

When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.

This antibody is a rabbit polyclonal antibody raised against mCherry. It can be used to detect mCherry, dsRed, tdTomato, and mScarlet.


Protocols

Product Specific Protocols
FC protocol for mCherry antibody 26765-1-APDownload protocol
IF protocol for mCherry antibody 26765-1-APDownload protocol
IP protocol for mCherry antibody 26765-1-APDownload protocol
WB protocol for mCherry antibody 26765-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB,IP,IF

Cell

The WDR11 complex is a receptor for acidic-cluster-containing cargo proteins

Authors - Huaqing Deng
WB

Nat Struct Mol Biol

Aurora kinase A-mediated phosphorylation triggers structural alteration of Rab1A to enhance ER complexity during mitosis

Authors - Wei Zhang
humanWB

Nat Commun

Stalled translation by mitochondrial stress upregulates a CNOT4-ZNF598 ribosomal quality control pathway important for tissue homeostasis

Authors - Ji Geng
WB

Nat Commun

TBC1D23 mediates Golgi-specific LKB1 signaling

Authors - Yingfeng Tu
humanIF

J Extracell Vesicles

Identification of the SNARE complex that mediates the fusion of multivesicular bodies with the plasma membrane in exosome secretion

Authors - Chuqi Liu

Adv Sci (Weinh)

A Viral RNA Silencing Suppressor Modulates Reactive Oxygen Species Levels to Induce the Autophagic Degradation of Dicer-Like and Argonaute-Like Proteins

Authors - Shiyu Zhai

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Vanessa (Verified Customer) (04-07-2026)

This antibody worked very well to evaluate the transduction efficiency of different capsid serotypes of rAAV:mCherry.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse Skeletal Muscle
mCherry Antibody Western Blot validation (1:100 dilution) in Mouse Skeletal Muscle (Cat no:26765-1-AP)
FH

Mounika (Verified Customer) (03-24-2026)

Very Good antibody, happy and easy to work to with!

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:800
FH

Diogo (Verified Customer) (03-03-2026)

This antibody worked very well and allowed me to detect rAAV transduction (by mCherry expression) in the heart of mice

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse heart
mCherry Antibody Immunofluorescence validation (1:100 dilution) in Mouse heart (Cat no:26765-1-AP)
FH

Christine (Verified Customer) (09-23-2025)

Very strong and clean western blot on cells transfected with a mCHERRY tagged protein. Very sensitive antibody, as good as the home made one we were trying to replace. The monoclonal rabbit one sold by Proteintech (81202-2-RR) is also excellent and clean (but a slightly less strong), but would another great choice.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5,000
FH

Alexandra (Verified Customer) (07-02-2024)

Not the strongest antibody I've ever used but it works fine, the maximum recomended dilution is 1000x, but possibly 500x would be more effective.

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation, Cell culture
  • Primary Antibody Dilution: 1000x
  • Cell Tissue Type: U2OS human osteosarcoma cell line
mCherry Antibody Western Blot,Immunofluorescence,Immunoprecipitation,Cell culture validation (1000x dilution) in U2OS human osteosarcoma cell line (Cat no:26765-1-AP)
FH

Verdiana (Verified Customer) (10-12-2023)

Nice and clear bands!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: U2OS
FH

Andrea (Verified Customer) (10-05-2023)

Good and strong signal for the mCherry fusion protein. In my case it was a 1:1000 dilution.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HCT-116
mCherry Antibody Western Blot validation (1:1000 dilution) in HCT-116 (Cat no:26765-1-AP)
FH

Tatyana (Verified Customer) (01-09-2023)

Excellent antibody, very good bright signal, no background or non-specific bands. HeLa cells were transfected with plasmids for expression of mCherry tagged proteins, lysed after 24 hours, followed by WB (semi-dry transfer, blocking in 4% milk). Antibody was diluted in 4% milk.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Human / HeLa cells
mCherry Antibody Western Blot validation (1:2000 dilution) in Human / HeLa cells (Cat no:26765-1-AP)
FH

Laura (Verified Customer) (01-14-2020)

Antibody was used in 5% TBST overnight, gave a clean blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: HEK293T
FH

Benjamin (Verified Customer) (12-10-2019)

This antibody has been used to image mCherry fusion proteins expressed in HEK293T cells via western blot with high rates of success.Antibody was diluted in 3% milk TBST and incubated overnight at 4 degrees.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: HEK293T Lysate
FH

Liang (Verified Customer) (05-27-2019)

The antibody works perfect. According the attached image, The 2nd from the left is the negative control protein (mGFP) and the 3rd lane is the mCherry protein as the positive control, the others are the target protein.

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: purified protein expressed from Ecoli
mCherry Antibody Western Blot,Immunoprecipitation, validation (1:3000 dilution) in purified protein expressed from Ecoli (Cat no:26765-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...