mCherry Polyclonal antibody, PBS Only

mCherry Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 26765-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

recombinant protein

Applications

WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Red fluorescence protein, red fluorescent protein, RFP, RFP-tag

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

26765-1-PBS targets mCherry in WB, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with recombinant protein samples.

Tested Reactivity recombinant protein
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25320

Product name: Recombinant mCherry protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-235 aa of

Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Predict reactive species
Full Name mCherry
Calculated Molecular Weight 27 kDa
Gene Symbol
Gene ID (NCBI)
RRIDAB_2876881
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Red fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages.

The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm).

When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.

This antibody is a rabbit polyclonal antibody raised against mCherry. It can be used to detect mCherry, dsRed, tdTomato, and mScarlet.


Loading...
||
New chat

Able

正在加载,请稍候...