mCherry Polyclonal antibody, PBS Only

• 

  WB analysis using 26765-1-AP (same clone as 26765-1-PBS)

  mCherry tagged protein was subjected to SDS PAGE followed by western blot with 26765-1-AP (mCherry antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26765-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 26765-1-AP (same clone as 26765-1-PBS)

  WB result of mCherry antibody (26765-1-AP; 1:2000; room temperature for 1.5 hours) with negative control and mCherry overexpressed Transfected HEK-293 cells. This data was developed using the same antibody clone with 26765-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 26765-1-AP (same clone as 26765-1-PBS)

  WB result of mCherry antibody (26765-1-AP; 1:300; room temperature for 1.5 hours) with negative control and mCherry overexpressed Transfected HEK-293 cells. This data was developed using the same antibody clone with 26765-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Transfected HEK-293T using 26765-1-AP (same clone as 26765-1-PBS)

  IP result of anti-mCherry (IP:26765-1-AP, 4ug; Detection:26765-1-AP 1:2000) with Transfected HEK-293T cells lysate 1280 ug. This data was developed using the same antibody clone with 26765-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Transfected HEK-293 using 26765-1-AP (same clone as 26765-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed Transfected HEK-293 cells using mCherry antibody (26765-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26765-1-PBS in a different storage buffer formulation.

mCherry Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 26765-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

recombinant protein

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

Red fluorescence protein, red fluorescent protein, RFP, RFP-tag

---

Product Information

26765-1-PBS targets mCherry in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with recombinant protein samples.

• Tested Reactivity: recombinant protein
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25320

  Product name: Recombinant mCherry protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of

  Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

• Full Name: mCherry
• Calculated Molecular Weight: 27 kDa
• RRID: AB_2876881
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Red fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages.

The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm).

When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.

This antibody is a rabbit polyclonal antibody raised against mCherry. It can be used to detect mCherry, dsRed, tdTomato, and mScarlet.