Tested Applications
| Positive WB detected in | NCI-H1299 cells, HEK-293 cells, HeLa cells, Y79 cells |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15129-1-AP targets ABLIM1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7258 Product name: Recombinant human ABLIM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 55-401 aa of BC002448 Sequence: DIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF Predict reactive species |
| Full Name | actin binding LIM protein 1 |
| Calculated Molecular Weight | 88 kDa |
| Observed Molecular Weight | 48-52 kDa, 105-110 kDa |
| GenBank Accession Number | BC002448 |
| Gene Symbol | ABLIM1 |
| Gene ID (NCBI) | 3983 |
| RRID | AB_2257767 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14639 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABLIM1 (actin-binding LIM protein 1) is a member of the LIM-domain protein family, mediating interactions between actin filaments and cytoplasmic targets. ABLIM1 has been reported as a cell cortex protein specifically in non-erythrocytes, and is critical for the formation of dense interwoven cortical actin meshwork. Due to the alternative splicing, ABLIM1 has multiple isoforms with predicted masses of 52, 70, and 88 kDa, respectively(PMID: 9245787). The phosphorylation or binding with SUMO2 may result in higher MW.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ABLIM1 antibody 15129-1-AP | Download protocol |
| WB protocol for ABLIM1 antibody 15129-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ABLIM1 polyclonal antibody (Cat# 15129-1-AP) has 9 citations published in journals including Nature Cell Biology, Circulation Research, Biomaterials, International Journal of Biological Sciences, Journal of Cellular Physiology, Frontiers in Oncology, Molecular Biology of the Cell, medRxiv, and bioRxiv. Research fields span cilia assembly and actin dynamics, cardiac mechanotransduction, osteoarthritis, hepatocellular carcinoma, osteoclastogenesis, uterine smooth muscle tumors, cytoskeletal protein organization, fibrotic lung disease, and ALS/FTD proteomic disruption.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.
| ||
Biomaterials Cell-free fat extract attenuates temporomandibular joint osteoarthritis via repressing ATF3-binding chromatin accessibility. | ||
Int J Biol Sci Rictor promotes cell migration and actin polymerization through regulating ABLIM1 phosphorylation in Hepatocellular Carcinoma.
| ||
J Cell Physiol Actin binding LIM 1 (abLIM1) negatively controls osteoclastogenesis by regulating cell migration and fusion.
| ||
Front Oncol A four-gene signature identified by integrated transcriptomic analysis for differential diagnosis and prognosis of uterine smooth muscle tumors |
Reviews
What customers say
One reviewer (Joleen Cheah) rated this product 1 star in a Western Blot application using MDCK GII cells at a 1:1000 dilution. The reviewer noted that ABLIM should appear around 87 kD, but the two prominent bands observed did not match the expected molecular weight — the top band was just above 100 kD and the lower band was below 75 kD, as determined using a BioRad Precision Plus Protein Standard.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joleen (Verified Customer) (05-29-2019) | ABLIM should be around 87kD, but the 2 prominent bands do not come near that molecular weight. The top band is just above the 100kD molecular weight marker and the lower band is below the 75kD molecular weight marker. (BioRad Precision Plus Protein Standard used).
 |
