• Featured Product
  • KD/KO Validated

ACTR3B Polyclonal antibody

ACTR3B Polyclonal Antibody for WB, IHC, ELISA
Cat No. 17022-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Actin-related protein ARP4, Actin-related protein 3B, Actin-like protein 3B, Actin related protein ARP4, Actin related protein 3B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, mouse pancreas tissue, HepG2 cells, K-562 cells, mouse brain tissue, rat brain tissue
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:150-1:600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17022-1-AP targets ACTR3B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10218

Product name: Recombinant human ACTR3B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 156-418 aa of BC008682

Sequence: RQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS

Predict reactive species
Full Name ARP3 actin-related protein 3 homolog B (yeast)
Calculated Molecular Weight 418 aa, 48 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC008682
Gene Symbol ACTR3B
Gene ID (NCBI) 57180
RRIDAB_2305069
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9P1U1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for ACTR3B antibody 17022-1-APDownload protocol
WB protocol for ACTR3B antibody 17022-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...