ADAM12 Polyclonal antibody

ADAM12 Polyclonal Antibody for ELISA
Cat No. 26928-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

ADAM 12, Disintegrin and metalloproteinase domain-containing protein 12, EC:3.4.24.-, MCMP, Meltrin-alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

26928-1-AP targets ADAM12 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17474

Product name: Recombinant human ADAM12 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 352-700 aa of BC060804

Sequence: NFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRESFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGTACRDSSNSCDLPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKVSKSSFAKCEMRDAKCGKIQCQGGASRPVIGTNAVSIETNIPLQQGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRQCQNISVFGVHECAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQ

Predict reactive species
Full Name ADAM metallopeptidase domain 12
Calculated Molecular Weight 909 aa, 100 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC060804
Gene Symbol ADAM12
Gene ID (NCBI) 8038
RRIDAB_2880689
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43184
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAM12, also named as MLTN and Meltrin-alpha, is involved in skeletal muscle regeneration, specifically at the onset of cell fusion. It is also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. ADAM12 is expressed in human malignant tumors. It is involved in the regulation of growth factor activities and integrin functions, leading to promotion of cell growth and invasion, although the precise mechanisms of these are not clear at the present time.(PMID:17355265) ADAM12's ability to degrade extracellular matrix components likely allows it to detach cancer cells from the basement membrane and assist them on their route to metastasis. But the protein's role not just as a biomarker of breast cancer but as a gateway to cancer cell migration is only now being understood. ADAM12 has 2 isoforms with the calculated molecular mass of 100 and 80 kDa, and this antibody can recognize all isoforms of ADAM12. ADAM12 has 4 forms: 120kd full-length form, 90 kDa mature (processed form that lack the prodomain), 50-68 kDa degradation product and 27 kDa prodomain.

Loading...
||
New chat

Able

正在加载,请稍候...