• Featured Product
  • KD/KO Validated

Adrenomedullin Polyclonal antibody

Adrenomedullin Polyclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 10778-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

ADM, AM, PAMP, Pro-adrenomedullin, Proadrenomedullin N-20 terminal peptide

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman placenta tissue, human pancreas cancer tissue, human kidney tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10778-1-AP targets Adrenomedullin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1197

Product name: Recombinant human ADM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-185 aa of BC015961

Sequence: MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL

Predict reactive species
Full Name adrenomedullin
Calculated Molecular Weight 20 kDa
GenBank Accession NumberBC015961
Gene Symbol Adrenomedullin/ADM
Gene ID (NCBI) 133
RRIDAB_2242255
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35318
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Adrenomedullin (AM) and proadrenomedullin N-terminal 20 peptide (PAMP) are two small active hormones derived from the expression of a single gene (Adm) that is expressed throughout the GI tract, including the mucosal epithelium, glandular duct cells, neuroendocrine cells, and smooth muscle cells of the GI tract, between the oral cavity and the rectum (PMID:10782362, PMID:27345325). These two peptides coexist in GI cells, where they regulate many physiological functions including vasodilation, angiogenesis, anti-inflammation, organ protection, and tissue repair. AM suppresses inflammatory cytokine production in the intestinal mucosa, improves vascular and lymphatic function, mucosal epithelial repair, and intestinal barrier function in animal models with intestinal inflammation (PMID:27965594, PMID:29311984). Molecular mass species of 18, 14, and 6 kDa were identified in tumor cell lysates and presumably represent AM precursor, processed intermediates, and the authentic peptide, respectively. There is also a 22-kDa immunoreactive species in two cancer cell lines, H720 and MCF-7 (PMID: 8798536).

Protocols

Product Specific Protocols
IF protocol for Adrenomedullin antibody 10778-1-APDownload protocol
IHC protocol for Adrenomedullin antibody 10778-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC,IF

J Cell Mol Med

Adrenomedullin Inhibits the Efficacy of Combined Immunotherapy and Targeted Therapy in Biliary Tract Cancer by Disrupting Endothelial Cell Functions

Authors - Zhengfeng Xuan
  • KD Validated
humanIF

Cells

Differentiation Trajectory of Limbal Stem and Progenitor Cells under Normal Homeostasis and upon Corneal Wounding.

Authors - Zhenwei Song
humanIHC

Cell Mol Life Sci

APE1 controls DICER1 expression in NSCLC through miR-33a and miR-130b.

Authors - Giulia Antoniali
humanWB

Prostate

Prostate fibroblasts enhance androgen receptor splice variant 7 expression in prostate cancer cells

Authors - Takeshi Sasaki
humanWB

CNS Neurosci Ther

Identification and validation of a glycolysis-related taxonomy for improving outcomes in glioma

Authors - Tianshu Ying
humanIF

Cell Biosci

Single-cell multi-omics analysis reveals candidate therapeutic drugs and key transcription factor specifically for the mesenchymal subtype of glioblastoma

Authors - Yufan Yang
Loading...
||
New chat Able
正在加载,请稍候...