Tested Applications
| Positive WB detected in | A431 cells, HepG2 cells |
| Positive IP detected in | PC-3 cells, HepG2 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28727-1-AP targets AHR in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28935 Product name: Recombinant human AHR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-300 aa of BC070080 Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC Predict reactive species |
| Full Name | aryl hydrocarbon receptor |
| Calculated Molecular Weight | 848 aa, 96 kDa |
| Observed Molecular Weight | 105-110 kDa |
| GenBank Accession Number | BC070080 |
| Gene Symbol | AHR |
| Gene ID (NCBI) | 196 |
| RRID | AB_2918196 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35869 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AHR antibody 28727-1-AP | Download protocol |
| IHC protocol for AHR antibody 28727-1-AP | Download protocol |
| IP protocol for AHR antibody 28727-1-AP | Download protocol |
| WB protocol for AHR antibody 28727-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Aryl Hydrocarbon Receptor (AhR) antibody (Cat# 28727-1-AP) has 54 citations published across 42 journals, including Nature Communications, Cell Discovery, Advanced Science, Biomaterials, Journal of Ethnopharmacology, and Acta Pharmaceutica Sinica B. Key research fields encompass gut microbiota–immune interactions, tryptophan metabolism, ferroptosis, multiple cancer types (hepatocellular, lung, glioblastoma, prostate), inflammatory bowel disease, neuroinflammation, liver disease, toxicology, and thymus regeneration. Primary applications are WB, IF, IHC, IP, and ChIP.
| Species | Application | Title |
|---|---|---|
Cell Mol Immunol The AhR-Ovol1-Id1 regulatory axis in keratinocytes promotes epidermal and immune homeostasis in atopic dermatitis-like skin inflammation | ||
Nat Commun Urolithin A activates aryl hydrocarbon receptor-NLRP6-mediated pathways in intestinal epithelial cells to modulate mucosal immunity and strengthen gut barrier integrity. | ||
Exp Mol Med Proline/serine-rich coiled-coil 1 alleviates atherosclerosis via remodeling tryptophan metabolism mediated by Akkermansia muciniphila. | ||
Cell Discov AR to GR switch modulates differential TDO2-Kyn-AhR signalling to promote the survival and recurrence of treatment-induced dormant cells in prostate cancer | ||
Cell Discov Gut microbiota-derived indole-3-acetic acid suppresses high myopia progression by promoting type I collagen synthesis | ||
J Nanobiotechnology Flos sophorae immaturus exosome-like nanovesicles alleviate ulcerative colitis by attenuating intestinal oxidative stress and inflammation through activating Aryl hydrocarbon receptor via gut microbiota and tryptophan metabolism regulation. |
