Tested Applications
| Positive WB detected in | HUVEC cells, HeLa cells, HepG2 cells, K-562 cells |
| Positive IF/ICC detected in | PC-12 cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24613-1-AP targets Angiopoietin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17938 Product name: Recombinant human ANGPT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 357-443 aa of BC126200 Sequence: NEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTG Predict reactive species |
| Full Name | angiopoietin 2 |
| Calculated Molecular Weight | 496 aa, 57 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC126200 |
| Gene Symbol | Angiopoietin 2 |
| Gene ID (NCBI) | 285 |
| RRID | AB_2879639 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15123 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Angiopoietin-2 (Ang2) is a growth factor belonging to the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway, one of the main pathways involved in angiogenesis. Angiopoietin-2 was identified through a cDNA library screening, shortly after the identification of angiopoietin-1. Angiopoietin-2, is a natural antagonist for Tie2 that disrupts in vivo angiogenesis. In adult mice and humans, Angiopoietin-2 is expressed only at sites of vascular remodeling. Angiopoietin-2 has also been found to be highly expressed in diverse tumor cells and plays an important role in tumor angiogenesis and inflammation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Angiopoietin 2 antibody 24613-1-AP | Download protocol |
| WB protocol for Angiopoietin 2 antibody 24613-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ANGPT2 antibody (Cat# 24613-1-AP) has accumulated 43 citations published in journals such as Nature Communications, Signal Transduction and Targeted Therapy, Cell Death & Disease, Oncogene, FASEB Journal, eLife, and others. Associated research fields include angiogenesis, oncology (hepatocellular carcinoma, esophageal squamous cell carcinoma, glioma, colorectal cancer), vascular biology, diabetic retinopathy, neurology (cerebral ischemia, spinal cord injury), reproductive medicine (pregnancy, endometriosis, pre-eclampsia), cardiology, immunology, and aging.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Aberrant Notch-signaling promotes tumor angiogenesis in esophageal squamous-cell carcinoma | ||
Nat Commun Ubiquitin ligase CHFR mediated degradation of VE-cadherin through ubiquitylation disrupts endothelial adherens junctions | ||
Exp Mol Med Akt1-dependent expression of angiopoietin 1 and 2 in vascular smooth muscle cells leads to vascular stabilization | ||
Cell Death Dis Decreased ZNF750 promotes angiogenesis in a paracrine manner via activating DANCR/miR-4707-3p/FOXC2 axis in esophageal squamous cell carcinoma. | ||
Cell Commun Signal KTX207-mediated PDE4D degradation disrupts tumour cell migration, invasion, and angiogenic potential. |
Reviews
What customers say
Both reviewers used this antibody for Western Blot and reported unsatisfactory results. One user (rated 2/5) observed several non-specific bands at a 1:2000 dilution in A549 cells. The other (rated 1/5) found the antibody not specific, binding at multiple molecular weights across tumoral cells, endothelial cells, and mouse fibroblasts at 1:500 and 1:1000 dilutions. Overall, the feedback highlights poor specificity and multiple off-target bands as the main concerns.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Angie (Verified Customer) (07-25-2025) | The antibody detected several bands at dilution of 1:2000 incubated at room temperature for 2 hours followed by secondary antibody donkey-anti-rabbit (Alexa Fluor 800) at 1:20000 dilution, incubated 1 hour at room temperature.
 |
Marine (Verified Customer) (07-01-2025) | It is not specific, it binds at different molecular weight on the ladder
 |
