ANKS1B Polyclonal antibody

ANKS1B Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 24783-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

AIDA, AIDA 1, Amyloid-beta protein intracellular domain-associated protein 1, ANKS2, Ankyrin repeat and sterile alpha motif domain-containing protein 1B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, mouse testis tissue
Positive IP detected inHeLa cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

24783-1-AP targets ANKS1B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20454

Product name: Recombinant human ANKS1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 446-510 aa of BC026313

Sequence: GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF

Predict reactive species
Full Name ankyrin repeat and sterile alpha motif domain containing 1B
Calculated Molecular Weight 1248 aa, 138 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC026313
Gene Symbol ANKS1B
Gene ID (NCBI) 56899
RRIDAB_2879720
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7Z6G8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANKS1B also named as AIDA or cajalin 2 is a amino acid protein, which contains 7 ANK repeats, 1 PID domain and 2 SAM domains. ANKS1B localizes in cytoplasm and is highly expressed in brain and testis. ANKS1B exists as many alternatively spliced isoforms. It interacts with AbPP to play a role in brain development. AIDA-1 also interacts with coilin in Cajal bodies to regulate pre-mRNA splicing.

Protocols

Product Specific Protocols
IF protocol for ANKS1B antibody 24783-1-APDownload protocol
IHC protocol for ANKS1B antibody 24783-1-APDownload protocol
IP protocol for ANKS1B antibody 24783-1-APDownload protocol
WB protocol for ANKS1B antibody 24783-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

EBioMedicine

Juvenile CLN3 disease is a lysosomal cholesterol storage disorder: similarities with Niemann-Pick type C disease

Authors - Jacinda Chen
Loading...
||
New chat Able
正在加载,请稍候...