Tested Applications
| Positive WB detected in | HeLa cells, HuH-7 cells, mouse brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human stomach cancer tissue, human thyroid cancer tissue, mouse colon tissue, rat colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10203-1-AP targets APEX1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0251 Product name: Recombinant human APEX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-318 aa of BC002338 Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL Predict reactive species |
| Full Name | APEX nuclease (multifunctional DNA repair enzyme) 1 |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC002338 |
| Gene Symbol | APEX1 |
| Gene ID (NCBI) | 328 |
| RRID | AB_2057927 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P27695 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
APEX1, also named as APE, APE1, HAP1 and REF-1, belongs to the DNA repair enzymes AP/ExoA family. It is a multifunctional protein that plays a central role in the cellular response to oxidative stress. The two major activities of APEX1 are in DNA repair and redox regulation of transcriptional factors. APEX nuclease is a DNA repair enzyme having apurinic/apyrimidinic (AP) endonuclease, 3-prime,5-prime-exonuclease, DNA 3-prime repair diesterase, and DNA 3-prime-phosphatase activities. On the other hand, APEX1 also exerts reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. APEX1 is involved in calcium-dependent down-regulation of parathyroid hormone (PTH) expression by binding to negative calcium response elements (nCaREs). When acetylated at Lys-6 and Lys-7, APEX1 stimulates the YBX1-mediated MDR1 promoter activity, leading to drug resistance. It also acts as an endoribonuclease involved in the control of single-stranded RNA metabolism. It plays a role in regulating MYC mRNA turnover by preferentially cleaving in between UA and CA dinucleotides of the MYC coding region determinant (CRD). In association with NMD1, APEX1 plays a role in the rRNA quality control process during cell cycle progression. 10203-1-AP is a rabbit polyclonal antibody raised against full length APE1 of human origin.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for APEX1 antibody 10203-1-AP | Download protocol |
| IHC protocol for APEX1 antibody 10203-1-AP | Download protocol |
| IP protocol for APEX1 antibody 10203-1-AP | Download protocol |
| WB protocol for APEX1 antibody 10203-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The APEX1 Polyclonal antibody (Cat# 10203-1-AP) has 39 total citations appearing in journals including Nucleic Acids Research, Science Advances, Cell Death & Differentiation, Cell Reports, Journal of Cell Biology, Molecular Therapy, Journal of Translational Medicine, Free Radical Biology and Medicine, and others. Associated research fields include DNA repair and base excision repair, cancer biology (hepatocellular, lung, colorectal, melanoma, osteosarcoma), ferroptosis, cardiovascular disease, neurology, toxicology, and immunology.
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res Oxidative damage within alternative DNA structures results in aberrant mutagenic processing | ||
Genes Dis Role of thioredoxin-interacting protein in mediating endothelial dysfunction in hypertension | ||
Sci Adv Deficiency in mammalian STN1 promotes colon cancer development via inhibiting DNA repair | ||
Cell Death Differ APE1 inhibition enhances ferroptotic cell death and contributes to hepatocellular carcinoma therapy
| ||
Cell Death Dis Small-molecule inhibition of APE1 induces apoptosis, pyroptosis, and necroptosis in non-small cell lung cancer. | ||
Cell Death Dis LINC00470 accelerates the proliferation and metastasis of melanoma through promoting APEX1 expression.
|
