Tested Applications
| Positive WB detected in | K-562 cells, mouse placenta tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14068-1-AP targets ARID3A in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5124 Product name: Recombinant human ARID3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 244-593 aa of BC060828 Sequence: FLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMEYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGSSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP Predict reactive species |
| Full Name | AT rich interactive domain 3A (BRIGHT-like) |
| Calculated Molecular Weight | 63 kDa |
| Observed Molecular Weight | 75 kDa |
| GenBank Accession Number | BC060828 |
| Gene Symbol | ARID3A |
| Gene ID (NCBI) | 1820 |
| RRID | AB_2060390 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99856 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARID3A is a nuclear matrix-associated transcription factor that stimulates immunoglobulin heavy chain (IgH) expression and Cyclin E1/E2F-dependent cell cycle progression. It activates IgH transcriptional initiation by binding to ATC-rich P sites within nuclear matrix attachment regions (MARs) flanking the IgH intronic enhancer (Emu) (PMID:17386101). It is the founder of the 13-member (in humans) ARID (AT-Rich Interaction Domain) family, which share a highly conserved DNA binding domain, but functions in diverse biological processes such as cell cycle regulated events, epigenetic post-translational modification, and chromatin remodeling (PMID:15927959,11959810,11283269). The expression molecular weight observed is consistent with what has been described in the literature (PMID: 15922553, 19436740).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ARID3A antibody 14068-1-AP | Download protocol |
| IHC protocol for ARID3A antibody 14068-1-AP | Download protocol |
| IP protocol for ARID3A antibody 14068-1-AP | Download protocol |
| WB protocol for ARID3A antibody 14068-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ARID3A antibody (Cat# 14068-1-AP) has 17 total citations spanning journals including Genes Dis, Advanced Science, Cell Reports Medicine, Cancer Letters, PLoS Genetics, FASEB Journal, and others. Research fields covered include pancreatic cancer chemoresistance, triple-negative breast cancer immunotherapy, colorectal cancer progression, hepatocellular carcinoma, renal fibrosis, osteosarcoma, ferroptosis regulation, and intestinal stem cell biology. Applications used include WB, IHC, ChIP, CoIP, IF, and IP in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Genes Dis IRP1/ARID3A complex promotes pancreatic cancer chemoresistance by suppressing CYGB-related ferroptosis.
| ||
Adv Sci (Weinh) Pharmacologic Modulation of ARID3A with Rimegepant Reactivates Type I Interferon Signaling and Sensitizes Triple-Negative Breast Cancer to PD-1 Blockade.
| ||
Cell Rep Med Personalized drug screening in patient-derived organoids of biliary tract cancer and its clinical application | ||
Cancer Lett LIN28B enhances the chemosensitivity of colon cancer cells via inducing genomic instability by upsetting the balance between the production and removal of reactive oxygen species | ||
Life Sci ARID3A inhibits colorectal cancer cell stemness and drug-resistance by targeting a multitude of stemness-associated genes | ||
Commun Biol Functional remodeling of iNKT cells by sulfatide-reactive type II NKT cells reprograms alveolar macrophages to alleviate lung ischemia-reperfusion injury. |
