Tested Applications
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13672-1-AP targets ATP11B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4654 Product name: Recombinant human ATP11B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 10-104 aa of BC033880 Sequence: SSGSAWFAIILMVVTCLFLDIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRCEISLSSLCCR Predict reactive species |
| Full Name | ATPase, class VI, type 11B |
| Calculated Molecular Weight | 1177aa, 134 kDa |
| GenBank Accession Number | BC033880 |
| Gene Symbol | ATP11B |
| Gene ID (NCBI) | 23200 |
| RRID | AB_2063150 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y2G3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATP11B antibody 13672-1-AP | Download protocol |
| IHC protocol for ATP11B antibody 13672-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ATP11B Polyclonal antibody (Cat# 13672-1-AP) has 3 citations published in J Immunother Cancer, Acta Neuropathol, and Life Science. The research fields span oncoimmunology (pancreatic cancer immunity via the ATP11B-PD-L1 axis), neuropathology (cerebral small vessel disease linked to ATP11B flippase expression), and cardiovascular biology (miRNA profiling in spontaneously hypertensive rats). Applications cited include WB, IHC, and IF across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
J Immunother Cancer Oncolytic peptide LTX-315 induces anti-pancreatic cancer immunity by targeting the ATP11B-PD-L1 axis.
| ||
Acta Neuropathol Loss of the heterogeneous expression of flippase ATP11B leads to cerebral small vessel disease in a normotensive rat model. | ||
Life Sci miRNA-150-5p associate with antihypertensive effect of epigallocatechin-3-gallate revealed by aorta miRNome analysis of spontaneously hypertensive rat. |
Reviews
What customers say
One reviewer rated this product 1 out of 5 stars. Using lot 00005228 for Western Blot and Immunofluorescence on platelets at dilutions of 1:1000 and 1:400 respectively, they reported never achieving any selective staining. The review was posted on June 1, 2025.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ruby (Verified Customer) (06-01-2025) | I never got any selective staining.
|
