Use Able AI chat for product recommendations

ATP1B1 Polyclonal antibody

ATP1B1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Sodium/potassium-transporting ATPase subunit beta-1, Sodium/potassium-dependent ATPase subunit beta-1, Na+/K+ ATPase beta 1 subunit, Na, K-ATPase β1, Beta 1 subunit of Na(+) K(+) ATPase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ATP1B1 in ?

Tested Applications

Positive WB detected inmouse brain tissue, human heart tissue, human brain tissue, mouse heart tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman brain tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15192-1-AP targets ATP1B1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7279

Product name: Recombinant human ATP1B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 59-303 aa of BC000006

Sequence: LTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

Predict reactive species
Full Name ATPase, Na+/K+ transporting, beta 1 polypeptide
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 45-52 kDa
GenBank Accession NumberBC000006
Gene Symbol ATP1B1
Gene ID (NCBI) 481
RRIDAB_2290040
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05026
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP1B1 is one of beta subunits of the Na+/K+ ATPase and responsible for formation and structural integrity of the Na+/K+ ATPase. The Na+/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)

Protocols

Product Specific Protocols
IF protocol for ATP1B1 antibody 15192-1-APDownload protocol
IHC protocol for ATP1B1 antibody 15192-1-APDownload protocol
IP protocol for ATP1B1 antibody 15192-1-APDownload protocol
WB protocol for ATP1B1 antibody 15192-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

ATP1B1 Polyclonal antibody (Cat# 15192-1-AP) has 18 total citations published across journals including Biomaterials, Molecular Therapy, Cell & Molecular Life Sciences, Molecular Metabolism, Journal of Biological Chemistry, Journal of Immunology, and others. Research fields span neuroscience (astrocytes, retinoschisis, neuropathic pain), cardiology, renal disease, metabolic regulation, innate immunity, and oncology.

SpeciesApplicationTitle
humanWB

Biomaterials

Astroglial membrane camouflaged Ptbp1 siRNA delivery hinders glutamate homeostasis via SDH/Nrf2 pathway

Authors - Yan Liu
mouseWB

Mol Ther

Harnessing patient-derived antibodies-induced microglial complement 1q expression: Novel therapy for anti-NMDAR encephalitis.

Authors - Bingtian Xu
mouseWB

Cell Mol Life Sci

PEBP4 deficiency aggravates LPS-induced acute lung injury and alveolar fluid clearance impairment via modulating PI3K/AKT signaling pathway

Authors - Qiao-Qing Shi
human, mouseIF,CoIP

Mol Metab

Glycolytic activation of β-cell Na(+)/K(+)-ATPases containing β1-subunits accelerates Na(+) extrusion, prolonging the duration of Ca(2+) oscillations but decreasing insulin secretion.

Authors - Matthew T. Dickerson

Drug Des Devel Ther

Xian Huang Fang Inhibits the PKCδ/MAPK Signaling Pathway to Attenuate Renal Tubular Epithelial Cell Senescence and Thereby Delay Renal Interstitial Fibrosis

Authors - Yanru Wang
ratWB

Int J Mol Sci

RBM20 Regulates CaV1.2 Surface Expression by Promoting Exon 9* Inclusion of CACNA1C in Neonatal Rat Cardiomyocytes.

Authors - Akihito Morinaga

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for 15192-1-AP is a 5-star rating from a researcher who used the antibody for Western Blot on Mouse Aorta tissue at a 1:4000 dilution (Lot 00054515). The reviewer noted that it works well with in vivo samples, indicating reliable performance on native tissue preparations.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Gaurav (Verified Customer) (02-27-2026)

Works with in vivo samples

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: Mouse Aorta
Loading...
||
New chat

Able™

正在加载,请稍候...