ATXN3L Polyclonal antibody

ATXN3L Polyclonal Antibody for WB, IHC, ELISA
Cat No. 23166-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

ataxin 3 like, ATX3L, ATXN3L, MJDL, Putative ataxin 3 like protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue
Positive IHC detected inhuman testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23166-1-AP targets ATXN3L in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19611

Product name: Recombinant human ATXN3L protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 180-341 aa of BC137187

Sequence: IISVEEMDTPKLNGKKLVKQKEHRVYKTVLEKVSEESDESGTSDQDEEDFQRALELSRQETNREDEHLRSTIELSMQGSSGNTSQDLPKTSCVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEDTVQAAVDTI

Predict reactive species
Full Name ataxin 3-like
Calculated Molecular Weight 355 aa, 41 kDa
Observed Molecular Weight 41 kDa
GenBank Accession NumberBC137187
Gene Symbol ATXN3L
Gene ID (NCBI) 92552
RRIDAB_2879221
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H3M9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATXN3L, also named as Ataxin-3-like protein, is a 355 amino acid protein, which contains 1 Josephin domain and 2 UIM (ubiquitin-interacting motif) domains. ATXN3L localizes in the nucleus and as a deubiquitinating enzyme that cleaves both 'Lys-48'-linked and 'Lys-63'-linked poly-ubiquitin chains.

Protocols

Product Specific Protocols
IHC protocol for ATXN3L antibody 23166-1-APDownload protocol
WB protocol for ATXN3L antibody 23166-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...