Home
Products
Primary Antibodies
APP/Beta Amyloid Polyclonal antibody (25524-1-AP)

Featured Product
KD/KO Validated

APP/Beta Amyloid Polyclonal antibody

APP/Beta Amyloid Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25524-1-AP

Publications(164)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

amyloid precursor protein, APP, A4 amyloid protein, AB40, AB42

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis using 25524-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 25524-1-AP (APP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HAP1 using 25524-1-AP
HAP1 (WT and APP KO) lysates prepared with RIPA buffer, 50μg protein loaded. 25524-1-AP incubated at 1:500 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown for each blot. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
×
HAP1 (WT and APP KO) lysates prepared with RIPA buffer, 50μg protein loaded. 25524-1-AP incubated at 1:500 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown for each blot. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
WB analysis using 25524-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 25524-1-AP (APP/Beta Amyloid antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 25524-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 25524-1-AP (APP/Beta Amyloid antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of 3T3-L1 using 25524-1-AP
3T3-L1 cells were subjected to SDS PAGE followed by western blot with 25524-1-AP (APP, C-Terminal antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HAP1 using 25524-1-AP
HAP1 lysates prepared and IP of APP performed using 2.0 μg of 25524-1-AP coupled to protein A- Dynabeads beads. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitate.These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
×
HAP1 lysates prepared and IP of APP performed using 2.0 μg of 25524-1-AP coupled to protein A- Dynabeads beads. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitate.These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
IHC staining of human gliomas using 25524-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 25524-1-AP (APP, C-Terminal antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 25524-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 25524-1-AP (APP, C-Terminal antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 25524-1-AP
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25524-1-AP (APP, C-Terminal antibody at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 25524-1-AP
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25524-1-AP (APP, C-Terminal antibody at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of SH-SY5Y using 25524-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using APP/Beta Amyloid antibody (25524-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (164)
Protocols
Reviews (2)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	SH-SY5Y cells, HAP1 cells, HeLa cells, NCI-H1299 cells, mouse brain tissue, rat brain tissue, C6 cells
Positive IHC detected in	human gliomas tissue, human brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	SH-SY5Y cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25524-1-AP targets APP/Beta Amyloid in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, rabbit, zebrafish
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22408 Product name: Recombinant human APP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 653-751 aa of BC065529 Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN Predict reactive species
Full Name	amyloid beta (A4) precursor protein
Observed Molecular Weight	100 kDa
GenBank Accession Number	BC065529
Gene Symbol	APP
Gene ID (NCBI)	351
RRID	AB_2880118
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P05067
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aβ derives from APP via proteolytic cleavage by proteases called α-, β- and γ-secretase. The α-secretase cleavage precludes the formation of Aβ, while the β- and γ-cleavages generate APP components with amyloidogenic features. Amyloid beta A4 precursor protein(APP), encoded by APP gene which locate on human chromosome 21q, is a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. APP expressed in all fetal tissues and is pronounced in brain, kidney, heart and spleen, but weak in liver. Defects in APP are the cause of Alzheimer disease type 1 (AD1). Amyloid β (Aβ) precursor protein (APP) is a 100-140 kDa transmembrane glycoprotein that exists as several isoforms. This antibody can recognize several isoforms of both mature and immature amyloid beta (A4) precursor protein, including APP770, APP677, APP695, APP696, APP733, APP751, APP752, and APP639. APP can be cleaved into several chains, this antibody could recognize fragments C99, Amyloid-beta protein 42, Amyloid-beta protein 40, C83, P3(40), C80, Gamma-secretase C-terminal fragment 59, Gamma-secretase C-terminal fragment 57, Gamma-secretase C-terminal fragment 50, C31.

Protocols

Product Specific Protocols
IF protocol for APP/Beta Amyloid antibody 25524-1-AP	Download protocol
IHC protocol for APP/Beta Amyloid antibody 25524-1-AP	Download protocol
WB protocol for APP/Beta Amyloid antibody 25524-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
mouse	WB,IF	Autophagy MLKL-USP7-UBA52 signaling is indispensable for autophagy in brain through maintaining ubiquitin homeostasis Authors - Zhigang Zhang View Article
		Autophagy Inflammatory signaling attenuates spliceosome function and cognitive ability Authors - Lan Lin View Article
		Nat Commun A circuit linking dentate gyrus and retrosplenial granular cortex regulates fracture healing in male mice. Authors - Wei Zhang View Article
rat	WB	NPJ Digit Med Machine learning-guided Huanglian Jiedu decoction targets STING in periodontitis-induced Alzheimer's Disease. Authors - Jie Li View Article
mouse	IF	Neuron Loss of PYCR2 Causes Neurodegeneration by Increasing Cerebral Glycine Levels via SHMT2. Authors - Nathalie Escande-Beillard View Article
mouse	IHC	Redox Biol Cognitive enhancement and neuroprotective effects of OABL, a sesquiterpene lactone in 5xFAD Alzheimer's disease mice model. Authors - Jiang-Jiang Tang View Article

Reviews

4.5 out of 5

Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Jorge (Verified Customer) (03-28-2023)

Test to evaluate the efficacy of the antibody. Tested on SH-SY5Y APPswe cells differentiated with 10 uM retic acid for 5 days. DAPT treatment 10 uM for 24h. Cells lysed with RIPA buffer. Loading different protein concentrations (ug). Tricine SDS-PAGE 16% acrylamide gel. Transfered on PVDF membrane. Blocking 5% milk. Dilution 1:4000 in TBS-Tw 0.05%.