Use Able AI chat for product recommendations

BARD1 Polyclonal antibody

BARD1 Polyclonal Antibody for WB, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

BARD 1, BARD-1, BRCA1 associated RING domain 1, BRCA1-associated RING domain protein 1, EC:2.3.2.27

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for BARD1 in ?

Tested Applications

Positive WB detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22964-1-AP targets BARD1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18965

Product name: Recombinant human BARD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 428-777 aa of BC126426

Sequence: GETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS

Predict reactive species
Full Name BRCA1 associated RING domain 1
Calculated Molecular Weight 777 aa, 87 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC126426
Gene Symbol BARD1
Gene ID (NCBI) 580
RRIDAB_2879190
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ99728
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BARD1 (BRCA1-associated RING domain protein 1) is a multifunctional protein that interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. Moreover, BARD1 is central to DNA repair, tumor suppression, and cancer predisposition.

Protocols

Product Specific Protocols
WB protocol for BARD1 antibody 22964-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The BARD1 Polyclonal antibody (Cat# 22964-1-AP) has 10 citations published in journals including Metabolism, Advanced Science, Cell Death & Disease, PLoS Biology, American Journal of Physiology, Molecules, BBA Molecular Basis of Disease, Discovery Oncology, and eLife. Research fields span lipid metabolism, cancer stem cell formation, non-small cell lung cancer, ovarian cancer, homologous recombination repair, BRCA1 stabilization, triple-negative breast cancer, hepatocellular carcinoma, and replication restart mechanisms.

SpeciesApplicationTitle

Metabolism

Natural polyketide enterocin inhibits ASGR1 to enhance cholesterol efflux and regulate hepatic lipid metabolism.

Authors - Yan Liu
humanWB

Adv Sci (Weinh)

CHB-Induced Immune Zonation Chaos Elicited LXRα-mediated Lipid Metabolism Disorders in Kupffer Cells to Induce Cancer Stem Cell Formation.

Authors - Jingqi Shi
humanWB

Cell Death Dis

Targeting FBXO22 enhances radiosensitivity in non-small cell lung cancer by inhibiting the FOXM1/Rad51 axis

Authors - Yunshang Chen
humanWB

Cell Death Dis

CBX2 phase-separation contributes to homologous recombination repair and drug resistance in ovarian cancer.

Authors - Si Sun
humanWB

PLoS Biol

The deubiquitinating enzyme Cezanne stabilizes BRCA1 by counteracting APC/C and Ube2S-dependent Lys11-linked ubiquitination.

Authors - Longqiang Wang
humanWB

Am J Physiol Cell Physiol

Synergistic Effects of Olaparib and Palbociclib in Resistant epithelial ovarian cancer

Authors - Shuo Wang

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for 22964-1-AP is from Vikas Maloji Rao (April 2025), who used the antibody for Western Blot on HEK-293 cells at a 1:1000 dilution. He rated it 5 stars and commented that it "worked very well" and is "highly recommended." Overall, the feedback is very positive, indicating strong performance and reliability in his application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Vikas (Verified Customer) (04-08-2025)

worked very well. Highly recommended.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1;1000
  • Cell Tissue Type: HEK-293
Loading...
||
New chat

Able™

正在加载,请稍候...