Use Able AI chat for product recommendations

Bestrophin-1 Monoclonal antibody

Bestrophin-1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 60326-1-Ig
Clone No. 4D5F1
Publications (5)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

ARB, BEST, BEST1, bestrophin 1, Bestrophin-1, BMD, TU15B, VMD2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Bestrophin-1 in ?

Tested Applications

Positive WB detected inY79 cells, Transfected HEK-293 cells
Positive IF/ICC detected inY79 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60326-1-Ig targets Bestrophin-1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15129

Product name: Recombinant human BEST1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 319-498 aa of BC015220

Sequence: ANSRTKLLWPKRESLLHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRDEAHS

Predict reactive species
Full Name bestrophin 1
Calculated Molecular Weight 585 aa, 68 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC015220
Gene Symbol Bestrophin/BEST1
Gene ID (NCBI) 7439
RRIDAB_2881436
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO76090
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Bestrophin-1 (BEST1) is a 68 kDa transmembrane protein which belongs to the bestrophin family of anion channels. It is predominantly expressed in the basolateral membrane of the retinal pigment epithelium. Studies show that bestrophin 1 functions as a Ca(2+)-dependent Cl(-) channel and modulator of voltage-dependent L-type Ca(2+) channels. It may also contribute to the basolateral cell conductance in airway epithelial cells. This protein is encoded by the VMD2 gene. Mutations in VMD2 can lead to different types of retinal or macular degenerations, including Best vitelliform macular dystrophy (BMD), autosomal recessive bestrophinopathy (ARB), autosomal dominant vitreoretinochoroidopathy (ADVIRC) and adult-onset vitelliform macular dystrophy (AVMD).

Protocols

Product Specific Protocols
IF protocol for Bestrophin-1 antibody 60326-1-IgDownload protocol
WB protocol for Bestrophin-1 antibody 60326-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Bestrophin-1 Monoclonal antibody (4D5F1), catalog number 60326-1-Ig, has 5 total citations. These appear in Cell Death & Disease, Neurobiology of Disease, Cell Signaling, Biomedical Materials, and STAR Protocols. The research fields span retinal pigment epithelial (RPE) cell biology and retinal degeneration, ER stress in epilepsy, BEST1 chloride channel function and mutant protein degradation, RPE cell growth on hydrogel matrices, and iPSC-derived RPE cell purification protocols.

SpeciesApplicationTitle
humanIF

Cell Death Dis

Direct conversion of human umbilical cord mesenchymal stem cells into retinal pigment epithelial cells for treatment of retinal degeneration

Authors - Xiaoman Zhu
human,ratWB

Neurobiol Dis

Best1 mitigates ER stress induced by the increased cellular microenvironment stiffness in epilepsy

Authors - Hao Wu
humanIF

Cell Signal

Hsp70/CHIP E3 ligase complex triggers K149-linked ubiquitination and degradation of BEST1 mutants p.P233L and p.P346H, impairing chloride channel function and retinal integrity.

Authors - Zhongxue Zhou
humanIF

Biomed Mater

Fib@PEGDA/GelMA hydrogel as a light-curing thin-layer matrix for RPE cell growth and function.

Authors - Naiwen Zhang

STAR Protoc

Protocol for purifying iPSC-derived retinal pigment epithelial cells by sequential digestion and intrinsic autofluorescence sorting.

Authors - Fengming Yang
Loading...
||
New chat

Able™

正在加载,请稍候...