CD147 Recombinant monoclonal antibody

CD147 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 82909-8-RR
Clone No.251215H8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

5F7, Basigin, BSG, Collagenase stimulatory factor, EMMPRIN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, RAW 264.7 cells, mouse spleen tissue
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82909-8-RR targets CD147 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0436

Product name: Recombinant Human CD147 protein (His Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 138-323 aa of BC009040

Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA

Predict reactive species
Full Name basigin (Ok blood group)
Calculated Molecular Weight 385 aa, 42 kDa
Observed Molecular Weight35-60 kDa
GenBank Accession NumberBC009040
Gene Symbol CD147
Gene ID (NCBI) 682
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35613
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). Increased expression of CD147 occurs in many tumors. CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211). CD147 has been identified as a receptor essential for erythrocyte invasion by Plasmodium falciparum (PMID: 22080952). It has been reported that spike protein of SARS-CoV-2 binds to CD147 on host cells, thereby mediating the viral invasion (Wang, Ke, et al, BioRxiv, 2020).

Protocols

Product Specific Protocols
IF protocol for CD147 antibody 82909-8-RRDownload protocol
IHC protocol for CD147 antibody 82909-8-RRDownload protocol
WB protocol for CD147 antibody 82909-8-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...