• Featured Product
  • KD/KO Validated

CD3 Recombinant monoclonal antibody

CD3 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 81324-1-RR
Clone No.4I19

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

CD3E, 4I19, CD3 epsilon, CD3-epsilon, T3E

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, MOLT-4 cells, pig thymus tissue, rat thymus tissue, mouse thymus tissue
Positive IHC detected inhuman colon tissue, human tonsillitis tissue, mouse small intestine tissue, mouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse spleen tissue, mouse small intestine tissue, human tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81324-1-RR targets CD3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11797

Product name: Recombinant human CD3E protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-207 aa of BC049847

Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Predict reactive species
Full Name CD3e molecule, epsilon (CD3-TCR complex)
Calculated Molecular Weight 207 aa, 23 kDa
Observed Molecular Weight23-25 kDa
GenBank Accession NumberBC049847
Gene Symbol CD3
Gene ID (NCBI) 916
ENSEMBL Gene IDENSG00000198851
RRIDAB_2935548
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07766
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This antibody is directed against the epsilon chain of human CD3 molecule.

Protocols

Product Specific Protocols
IF protocol for CD3 antibody 81324-1-RRDownload protocol
IHC protocol for CD3 antibody 81324-1-RRDownload protocol
WB protocol for CD3 antibody 81324-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Front Immunol

Efficacy and safety evaluation of cross-reactive Fibroblast activation protein scFv-based CAR-T cells

Authors - Wenhao Niu
IF

Cancer Immunol Immunother

A high proportion of CD38 (high) CD16 (low) NK cells in colorectal cancer can interrupt immune surveillance and favor tumor growth

Authors - Xueling Wang
humanIHC

J Transl Med

Prognostic implications and characterization of tumor-associated tertiary lymphoid structures genes in pancreatic cancer

Authors - Enkui Zhang

Viruses

Early Highly Pathogenic Porcine Reproductive and Respiratory Syndrome Virus Infection Induces Necroptosis in Immune Cells of Peripheral Lymphoid Organs

Authors - Jiawei Xu
Loading...
||
New chat

Able

正在加载,请稍候...