Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, MKN-45 cells, human placenta tissue, K-562 cells |
| Positive IHC detected in | human lung cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
82781-6-RR targets CD55 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25026 Product name: Recombinant human CD55 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 35-126 aa of BC001288 Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE Predict reactive species |
| Full Name | CD55 molecule, decay accelerating factor for complement (Cromer blood group) |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 75 kDa |
| GenBank Accession Number | BC001288 |
| Gene Symbol | CD55 |
| Gene ID (NCBI) | 1604 |
| RRID | AB_3086534 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P08174 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044). The observed molecular weight of mature CD55 varies between 50 to 100 kDa depending on the cell type. Different sizes of CD55 might be caused by alternative splicing or different glycosylation patterns (PMID: 29503741).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD55 antibody 82781-6-RR | Download protocol |
| IHC protocol for CD55 antibody 82781-6-RR | Download protocol |
| WB protocol for CD55 antibody 82781-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Maxence (Verified Customer) (01-26-2026) | This CD55 works perfectly in IF-P. The staining is well localized in the germinal centers of the tonsil, as expected. The IF was performed on FFPE human tonsil tissue slide with Dako antigen retrival pH9. Primary incubation was performed at 1:100 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Rabbit at 1:1000 for 1h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.
![]() |
















