Use Able AI chat for product recommendations

CD55 Recombinant monoclonal antibody

CD55 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 82781-6-RR
Clone No.2D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, CoIP, ELISA

2D2, Complement decay-accelerating factor, CR, CROM, DAF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells, MKN-45 cells, human placenta tissue, K-562 cells
Positive IHC detected inhuman lung cancer tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82781-6-RR targets CD55 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25026

Product name: Recombinant human CD55 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 35-126 aa of BC001288

Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE

Predict reactive species
Full Name CD55 molecule, decay accelerating factor for complement (Cromer blood group)
Calculated Molecular Weight 41 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberBC001288
Gene Symbol CD55
Gene ID (NCBI) 1604
RRIDAB_3086534
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08174
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044). The observed molecular weight of mature CD55 varies between 50 to 100 kDa depending on the cell type. Different sizes of CD55 might be caused by alternative splicing or different glycosylation patterns (PMID: 29503741).

Protocols

Product Specific Protocols
IF protocol for CD55 antibody 82781-6-RRDownload protocol
IHC protocol for CD55 antibody 82781-6-RRDownload protocol
WB protocol for CD55 antibody 82781-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF,CoIP

Cell Death Dis

GDPD5-CD55-EGFR competitive binding axis regulates radioresistance and lipid accumulation in rectal cancer.

Authors - Ruiqiu Zhu
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Maxence (Verified Customer) (01-26-2026)

This CD55 works perfectly in IF-P. The staining is well localized in the germinal centers of the tonsil, as expected. The IF was performed on FFPE human tonsil tissue slide with Dako antigen retrival pH9. Primary incubation was performed at 1:100 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Rabbit at 1:1000 for 1h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Tonsil
CD55 Antibody Immunofluorescence validation (1:100 dilution) in Human Tonsil (Cat no:82781-6-RR)
Loading...
||
New chat

Able

正在加载,请稍候...