CD74 Recombinant monoclonal antibody

CD74 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85802-1-RR
Clone No.250109F2

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Class-II-associated invariant chain peptide, CLIP, H-2 class II histocompatibility antigen gamma chain, Ia antigen-associated invariant chain, Ii

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA20 cells, RAW 264.7 cells, mouse small intestine tissue, mouse lung tissue, mouse thymus tissue, mouse spleen tissue, rat spleen tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85802-1-RR targets CD74 in WB, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2716

Product name: Recombinant Mouse Cd74 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 56-279 aa of NM_001042605.1

Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Predict reactive species
Full Name CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)
Calculated Molecular Weight32 kDa
Observed Molecular Weight38 kDa
GenBank Accession NumberNM_001042605.1
Gene Symbol Cd74
Gene ID (NCBI) 16149
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04441-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165; PMID: 36712241).

Protocols

Product Specific Protocols
WB protocol for CD74 antibody 85802-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...