Tested Applications
| Positive WB detected in | HT-29 cells, MCF-7 cells, human saliva |
| Positive IHC detected in | human colon cancer tissue, human appendicitis tissue, human stomach cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human colon cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10421-1-AP targets CEA/CD66e in WB, IHC, IF-P, chIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0672 Product name: Recombinant human CEACAM5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC034671 Sequence: MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ Predict reactive species |
| Full Name | carcinoembryonic antigen-related cell adhesion molecule 5 |
| Calculated Molecular Weight | 77 kDa |
| Observed Molecular Weight | 180-200 kDa, 77 kDa |
| GenBank Accession Number | BC034671 |
| Gene Symbol | CEA |
| Gene ID (NCBI) | 1048 |
| RRID | AB_2244691 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06731 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Carcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e, is a cell surface glycoprotein belonging to the immunoglobulin superfamily, mainly serving as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEA inhibits anoikis and plays a role in tumorigenesis and metastasis. CEA has been found to be overexpressed in a wide variety of human cancers, including colon, breast, and lung (PMID: 17167768). CEA is a tumor marker and is routinely exploited for diagnosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CEA/CD66e antibody 10421-1-AP | Download protocol |
| IHC protocol for CEA/CD66e antibody 10421-1-AP | Download protocol |
| WB protocol for CEA/CD66e antibody 10421-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-CEACAM5 (Cat# 10421-1-AP) has 17 total citations spanning journals including Nature Biomedical Engineering, Nature Aging, Cancer Letters, International Journal of Biological Sciences, Journal for Immunotherapy of Cancer, and others. Research fields cover colorectal and gastric cancer biology, extracellular vesicle characterization, tumor immunosuppression, organoid-based drug screening, aging signatures, and SARS-CoV2-related endothelial injury. Applications include WB, IHC, IF, and ChIP.
| Species | Application | Title |
|---|---|---|
Nat Biomed Eng Rapid and sensitive detection of cancer-derived small extracellular vesicles using Janus particles. | ||
Nat Aging Sex-specific aging clocks from a large-scale human phenome reveal distinct aging transitions and circulating signatures | ||
Cancer Lett Tumor-derived CDHR2-enriched extracellular vesicles engage ANPEP on liver sinusoidal endothelial cells to facilitate transendothelial migration in PDAC. | ||
Int J Biol Sci FBW7 suppresses metastasis of colorectal cancer by inhibiting HIF1α/CEACAM5 functional axis.
| ||
J Immunother Cancer CD146+ CAFs mediate immunosuppression in gastric cancer via COL4A1: potential therapeutic targets | ||
J Colloid Interface Sci Engineering a cancer organoid-based platform for the early preclinical evaluation of the antitumor efficacy and safety of hydrophilic 2D metallic MoS(2) nanosheets. |
Reviews
What customers say
One reviewer (Claire O.) gave a 5-star rating for lot 00120713, used in IHC and IF on colorectal adenocarcinoma and pancreatic carcinoma tissues. She described it as a repeat order based on previously excellent imaging results in colorectal adenocarcinoma research, and noted she was now optimizing the antibody for pancreatic applications. Overall, the feedback is positive, highlighting reliable performance and consistent image quality across repeated use.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Claire (Verified Customer) (09-30-2024) | A repeat order of an antibody previously used in colorectal adenocarcinoma research as this produced excellent images previously, we are now aiming to optimise this antibody for pancreatic work
|
