Filter: AllWBIHCIF-P

WB analysis using 10421-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10421-1-AP (CEA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of MCF-7 using 10421-1-AP
MCF-7 cells were subjected to SDS PAGE followed by western blot with 10421-1-AP (CEA antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
IHC staining of human colon cancer using 10421-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10421-1-AP (CEA antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon cancer using 10421-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10421-1-AP (CEA antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 10421-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer using 10421-1-AP (CEA antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human stomach cancer using 10421-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer using 10421-1-AP (CEA antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human lung cancer using 10421-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10421-1-AP (CEA antibody at dilution of 1:200 (under 10x lens).
IHC staining of human lung cancer using 10421-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10421-1-AP (CEA antibody at dilution of 1:200 (under 40x lens).
IHC staining of human appendicitis using 10421-1-AP
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 10421-1-AP (CEA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of human colon cancer using 10421-1-AP
Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CEA antibody (10421-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
IF Staining of human colon cancer using 10421-1-AP
Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CEA antibody (10421-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Featured Product
KD/KO Validated

CEA/CD66e Polyclonal antibody

Name: CEA/CD66e Polyclonal antibody
Brand: Proteintech
SKU: 10421-1-AP
Rating: 5.00 (1 reviews)

CEA/CD66e Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 10421-1-AP

Publications(9)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, chIP, ELISA

Synonyms

CEA, Meconium antigen 100, CEACAM5, CD66e, Carcinoembryonic antigen-related cell adhesion molecule 5

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (9)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HT-29 cells, MCF-7 cells, human saliva
Positive IHC detected in	human colon cancer tissue, human appendicitis tissue, human stomach cancer tissue, human lung cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human colon cancer tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:200-1:800
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 1 publications below
WB	See 5 publications below
IHC	See 4 publications below
ChIP	See 1 publications below

Product Information

10421-1-AP targets CEA/CD66e in WB, IHC, IF-P, chIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0672 Product name: Recombinant human CEACAM5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC034671 Sequence: MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ Predict reactive species
Full Name	carcinoembryonic antigen-related cell adhesion molecule 5
Calculated Molecular Weight	77 kDa
Observed Molecular Weight	180-200 kDa, 77 kDa
GenBank Accession Number	BC034671
Gene Symbol	CEA
Gene ID (NCBI)	1048
RRID	AB_2244691
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P06731
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e, is a cell surface glycoprotein belonging to the immunoglobulin superfamily, mainly serving as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEA inhibits anoikis and plays a role in tumorigenesis and metastasis. CEA has been found to be overexpressed in a wide variety of human cancers, including colon, breast, and lung (PMID: 17167768). CEA is a tumor marker and is routinely exploited for diagnosis.

Protocols

Product Specific Protocols
IF protocol for CEA/CD66e antibody 10421-1-AP	Download protocol
IHC protocol for CEA/CD66e antibody 10421-1-AP	Download protocol
WB protocol for CEA/CD66e antibody 10421-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Transl Res Molecular signature of interleukin-22 in colon carcinoma cells and organoid models. Authors - Ina Rudloff View Article
human	WB	J Cell Mol Med CD39 Contributes to the Ability of Cell Invasion in Heterogeneity of Colorectal Cancer Authors - Xiaosong Li View Article
human	WB,IHC,chIP	Int J Biol Sci FBW7 suppresses metastasis of colorectal cancer by inhibiting HIF1α/CEACAM5 functional axis. Authors - Qingguo Li KD Validated View Article
human	IHC	Gene Ther Lentivirus-mediated RASSF1A expression suppresses aggressive phenotypes of gastric cancer cells in vitro and in vivo. Authors - P-H Zhou View Article
human	IHC	World Neurosurg Discovery of Aquaporin-1 and Aquaporin-4 Expression in an Intramedullary Spinal Cord Ependymal Cyst: Case Report. Authors - Matthew J Shepard View Article
human	WB	PLoS One Correlation of alpha-1 antitrypsin levels and exosome associated neutrophil elastase endothelial injury in subjects with SARS-CoV2 infection Authors - Jorge Lascano View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Claire (Verified Customer) (09-30-2024)

A repeat order of an antibody previously used in colorectal adenocarcinoma research as this produced excellent images previously, we are now aiming to optimise this antibody for pancreatic work